Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit Annexin A7 Polyclonal Antibody | anti-Anxa7 antibody

Annexin A7 antibody

Gene Names
Anxa7; Anx7; synexin; AI265384; AI316497
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
Annexin A7; Polyclonal Antibody; Annexin A7 antibody; Polyclonal Annexin A7; Anti-Annexin A7; Annexin A-7; ANXA7; Annexin A 7; anti-Anxa7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Annexin A7 antibody was raised against the N terminal of ANXA7
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ANXA7 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
463
Applicable Applications for anti-Anxa7 antibody
Western Blot (WB)
Application Notes
WB: 1.25 ug/ml
Biological Significance
Annexin A7 is a member of the annexin family of calcium-dependent phospholipid binding proteins. The Annexin A7 gene contains 14 exons and spans approximately 34 kb of DNA. Structural analysis of the protein suggests that Annexin A7 is a membrane binding protein with diverse properties including voltage-sensitive calcium channel activity, ion selectivity and membrane fusion.
Cross-Reactivity
Human
Immunogen
Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-Anxa7 antibody
Rabbit polyclonal Annexin A7 antibody raised against the N terminal of ANXA7
Product Categories/Family for anti-Anxa7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51 kDa (MW of target protein)
NCBI Official Full Name
annexin A7
NCBI Official Synonym Full Names
annexin A7
NCBI Official Symbol
Anxa7
NCBI Official Synonym Symbols
Anx7; synexin; AI265384; AI316497
NCBI Protein Information
annexin A7
UniProt Protein Name
Annexin A7
Protein Family
UniProt Gene Name
Anxa7
UniProt Synonym Gene Names
Anx7
UniProt Entry Name
ANXA7_MOUSE

Uniprot Description

ANXA7: Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. Interacts with PDCD6. Isoform 1 is expressed in brain, heart and skeletal muscle. Isoform 2 is more abundant in liver, lung, kidney, spleen, fibroblasts and placenta. Belongs to the annexin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Calcium-binding; Lipid-binding

Cellular Component: endoplasmic reticulum membrane; membrane; cell; plasma membrane; nuclear envelope; cytosol; nucleus; vesicle

Molecular Function: integrin binding; protein binding; calcium-dependent phospholipid binding; calcium ion binding; calcium-dependent protein binding

Biological Process: cellular calcium ion homeostasis; regulation of cell shape; cell proliferation; cellular water homeostasis; hemostasis; autophagy; response to calcium ion; response to organic cyclic substance; response to salt stress

Research Articles on Anxa7

Similar Products

Product Notes

The Anxa7 anxa7 (Catalog #AAA5300112) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Annexin A7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1.25 ug/ml. Researchers should empirically determine the suitability of the Anxa7 anxa7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Annexin A7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.