Mouse anti-Human CARD17 Monoclonal Antibody | anti-CARD17 antibody

CARD17 (Caspase Recruitment Domain Family, Member 17, INCA, Inhibitory Caspase Recruitment Domain Protein)

Cat. Num. AAA6001145

• Gene Names: CARD17; INCA
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CARD17; Monoclonal Antibody; CARD17 (Caspase Recruitment Domain Family; Member 17; INCA; Inhibitory Caspase Recruitment Domain Protein); Anti -CARD17 (Caspase Recruitment Domain Family; anti-CARD17 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G6
• Specificity: Recognizes human CARD17.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS

• Applicable Applications for anti-CARD17 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.; Dilution: Sandwich ELISA: The detection limit is ~1ng/ml as a capture antibody.
• Immunogen: Full length recombinant protein corresponding to aa1-110 from human CARD17 (NP_001007233) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.9kD).)

Western Blot (WB)

(Western Blot analysis of CARD17 expression in transfected 293T cell line by CARD17 monoclonal antibody.|Lane 1: CARD17 transfected lysate (11.9kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CARD17 is 1ng/ml as a capture antibody.)

Related Product Information for anti-CARD17 antibody

Regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, do not induce NF-kappa-B activation.

Product Categories/Family for anti-CARD17 antibody

Antibodies; Abs to Apoptosis; Caspase

NCBI and Uniprot Product Information

• NCBI GI #: 55925612
• NCBI GeneID: 440068
• NCBI Accession #: NP_001007233.1
• NCBI GenBank Nucleotide #: NM_001007232.1
• UniProt Accession #: Q5XLA6
• Molecular Weight: 11,868 Da
• NCBI Official Full Name: caspase recruitment domain-containing protein 17
• NCBI Official Synonym Full Names: caspase recruitment domain family, member 17
• NCBI Official Symbol: CARD17
• NCBI Official Synonym Symbols: INCA
• NCBI Protein Information: caspase recruitment domain-containing protein 17; Inhibitory CARD; caspase-1 inhibitor INCA; inhibitory caspase recruitment domain protein; inhibitory caspase recruitment domain (CARD) protein
• UniProt Protein Name: Caspase recruitment domain-containing protein 17
• Protein Family: Caspase recruitment domain-containing protein
• UniProt Gene Name: CARD17
• UniProt Synonym Gene Names: INCA
• UniProt Entry Name: CAR17_HUMAN

Uniprot Description

CARD17: Regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, do not induce NF-kappa-B activation.

Chromosomal Location of Human Ortholog: 11q22.3

Cellular Component: cytoplasm

Molecular Function: cysteine protease inhibitor activity

Biological Process: regulation of apoptosis