Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CECR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Rabbit anti-Human ADA2 Polyclonal Antibody | anti-ADA2 antibody

ADA2 Antibody - N-terminal region

Gene Names
ADA2; PAN; ADGF; CECR1; IDGFL; SNEDS
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADA2; Polyclonal Antibody; ADA2 Antibody - N-terminal region; anti-ADA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MQFRFAHPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHP
Sequence Length
511
Applicable Applications for anti-ADA2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CECR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CECR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-CECR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Related Product Information for anti-ADA2 antibody
This is a rabbit polyclonal antibody against CECR1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein is one of two adenosine deaminases found in humans, which regulate levels of the signaling molecule, adenosine. The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-ADA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Synonym Full Names
adenosine deaminase 2
NCBI Official Symbol
ADA2
NCBI Official Synonym Symbols
PAN; ADGF; CECR1; IDGFL; SNEDS
NCBI Protein Information
adenosine deaminase 2
UniProt Protein Name
Adenosine deaminase CECR1
Protein Family
UniProt Gene Name
CECR1
UniProt Synonym Gene Names
ADA2; ADGF; IDGFL

NCBI Description

This gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein is one of two adenosine deaminases found in humans, which regulate levels of the signaling molecule, adenosine. The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Uniprot Description

CECR1: Adenosine deaminase that may contribute to the degradation of extracellular adenosine, a signaling molecule that controls a variety of cellular responses. Requires elevated adenosine levels for optimal enzyme activity. Binds to cell surfaces via proteoglycans and may play a role in the regulation of cell proliferation and differentiation, independently of its enzyme activity. Belongs to the adenosine and AMP deaminases family. ADGF subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.5.4.4; Hydrolase; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 22q11.1

Cellular Component: cytosol; extracellular region; extracellular space

Molecular Function: adenosine deaminase activity; adenosine receptor binding; growth factor activity; protein homodimerization activity; proteoglycan binding; zinc ion binding

Biological Process: adenosine catabolic process; cellular protein metabolic process; hypoxanthine salvage; inosine biosynthetic process

Disease: Polyarteritis Nodosa, Childhood-onset; Sneddon Syndrome

Research Articles on ADA2

Similar Products

Product Notes

The ADA2 cecr1 (Catalog #AAA3208515) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADA2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADA2 cecr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MQFRFAHPTP RPSEKCSKWI LLEDYRKRVQ NVTEFDDSLL RNFTLVTQHP. It is sometimes possible for the material contained within the vial of "ADA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.