Mouse anti-Human CECR1 Monoclonal Antibody | anti-CECR1 antibody

CECR1 (Adenosine Deaminase CECR1, Cat Eye Syndrome Critical Region Protein 1, ADA2, ADGF, IDGFL) APC

Cat. Num. AAA6135841

• Gene Names: ADA2; PAN; ADGF; CECR1; IDGFL; SNEDS; VAIHS
• Reactivity: Human
• Applications: Immunoprecipitation, Western Blot
• Purity: Purified
• Synonyms: CECR1; Monoclonal Antibody; CECR1 (Adenosine Deaminase CECR1; Cat Eye Syndrome Critical Region Protein 1; ADA2; ADGF; IDGFL) APC; anti-CECR1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3D11
• Specificity: Recognizes human CECR1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CECR1 antibody: FLISA, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa402-511 from human CECR1 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDKFIADVATK
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of CECR1 transfected lysate using MBS6007561 and Protein A Magnetic Bead and immunoblotted with CECR1 rabbit polyclonal antibody.)

Western Blot (WB)

(Western Blot detection against immunogen using MBS6007561 (38.21kD).)

Testing Data

(Detection limit is 0.3ng/ml using MBS6007561 as a capture antibody.)

Related Product Information for anti-CECR1 antibody

Adenosine deaminase that may contribute to the degradation of extracellular adenosine, a signaling molecule that controls a variety of cellular responses. Requires elevated adenosine levels for optimal enzyme activity. Binds to cell surfaces via proteoglycans and may play a role in the regulation of cell proliferation and differentiation, independently of its enzyme activity.

Product Categories/Family for anti-CECR1 antibody

Antibodies; Disease Markers

NCBI and Uniprot Product Information

• NCBI GI #: 29029550
• NCBI GeneID: 51816
• NCBI Accession #: NP_059120
• NCBI GenBank Nucleotide #: NM_017424
• UniProt Accession #: Q8NCJ2; Q6ICF1; Q86UB6; Q96K41; A8K9H4; Q9NZK5
• Molecular Weight: 30,668 Da
• NCBI Official Synonym Full Names: adenosine deaminase 2
• NCBI Official Symbol: ADA2
• NCBI Official Synonym Symbols: PAN; ADGF; CECR1; IDGFL; SNEDS; VAIHS
• NCBI Protein Information: adenosine deaminase 2
• UniProt Protein Name: Adenosine deaminase CECR1
• Protein Family: Adenosine deaminase
• UniProt Gene Name: CECR1
• UniProt Synonym Gene Names: ADA2; ADGF; IDGFL
• UniProt Entry Name: CECR1_HUMAN

NCBI Description

This gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein is one of two adenosine deaminases found in humans, which regulate levels of the signaling molecule, adenosine. The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]