Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AAMP AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellAAMP is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit AAMP Polyclonal Antibody | anti-AAMP antibody

AAMP antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AAMP; Polyclonal Antibody; AAMP antibody - middle region; anti-AAMP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGD
Sequence Length
434
Applicable Applications for anti-AAMP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AAMP AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellAAMP is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-AAMP AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellAAMP is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-AAMP antibody
This is a rabbit polyclonal antibody against AAMP. It was validated on Western Blot

Target Description: The gene product is an immunoglobulin-type protein. It is found to be expressed strongly in endothelial cells, cytotrophoblasts, and poorly differentiated colon adenocarcinoma cells found in lymphatics. The protein contains a heparin-binding domain and mediates heparin-sensitive cell adhesion.
Product Categories/Family for anti-AAMP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
14
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
angio-associated migratory cell protein isoform 2
NCBI Official Synonym Full Names
angio associated migratory cell protein
NCBI Official Symbol
AAMP
NCBI Protein Information
angio-associated migratory cell protein
UniProt Protein Name
Angio-associated migratory cell protein
UniProt Gene Name
AAMP
UniProt Entry Name
AAMP_HUMAN

NCBI Description

The gene is a member of the immunoglobulin superfamily. The encoded protein is associated with angiogenesis, with potential roles in endothelial tube formation and the migration of endothelial cells. It may also regulate smooth muscle cell migration via the RhoA pathway. The encoded protein can bind to heparin and may mediate heparin-sensitive cell adhesion. [provided by RefSeq, Oct 2014]

Uniprot Description

AAMP: Plays a role in angiogenesis and cell migration. In smooth muscle cell migration, may act through the RhoA pathway.

Protein type: Motility/polarity/chemotaxis; Cell development/differentiation; Cell surface

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: cell surface; cytoplasm; plasma membrane

Molecular Function: heparin binding

Biological Process: smooth muscle cell migration; angiogenesis; cell differentiation

Research Articles on AAMP

Similar Products

Product Notes

The AAMP aamp (Catalog #AAA3216398) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AAMP antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AAMP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AAMP aamp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKVWQVDTKE EVWSFEAGDL EWMEWHPRAP VLLAGTADGN TWMWKVPNGD. It is sometimes possible for the material contained within the vial of "AAMP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.