Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TSNAX AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellTSNAX is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Rabbit TSNAX Polyclonal Antibody | anti-TSNAX antibody

TSNAX antibody - middle region

Gene Names
TSNAX; C3PO; TRAX
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TSNAX; Polyclonal Antibody; TSNAX antibody - middle region; anti-TSNAX antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QHFIKTRSLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVT
Sequence Length
290
Applicable Applications for anti-TSNAX antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Rabbit: 100%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TSNAX AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellTSNAX is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (WB Suggested Anti-TSNAX AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellTSNAX is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-TSNAX antibody
This is a rabbit polyclonal antibody against TSNAX. It was validated on Western Blot

Target Description: This gene encodes a protein which specifically interacts with translin, a DNA-binding protein that binds consensus sequences at breakpoint junctions of chromosomal translocations. The encoded protein contains bipartite nuclear targeting sequences that may provide nuclear transport for translin, which lacks any nuclear targeting motifs.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
translin-associated protein X
NCBI Official Synonym Full Names
translin associated factor X
NCBI Official Symbol
TSNAX
NCBI Official Synonym Symbols
C3PO; TRAX
NCBI Protein Information
translin-associated protein X
UniProt Protein Name
Translin-associated protein X
UniProt Gene Name
TSNAX
UniProt Synonym Gene Names
TRAX
UniProt Entry Name
TSNAX_HUMAN

NCBI Description

This gene encodes a protein which specifically interacts with translin, a DNA-binding protein that binds consensus sequences at breakpoint junctions of chromosomal translocations. The encoded protein contains bipartite nuclear targeting sequences that may provide nuclear transport for translin, which lacks any nuclear targeting motifs. [provided by RefSeq, Jul 2008]

Uniprot Description

TSNAX: Acts in combination with TSN as an endonuclease involved in the activation of the RNA-induced silencing complex (RISC). Possible role in spermatogenesis. Belongs to the translin family.

Protein type: Nuclear receptor co-regulator; DNA-binding

Chromosomal Location of Human Ortholog: 1q42.1

Cellular Component: Golgi apparatus; perinuclear region of cytoplasm; cytoplasm; cytosol; nucleus

Molecular Function: endoribonuclease activity; DNA binding; sequence-specific DNA binding; metal ion binding; single-stranded DNA binding; protein transporter activity

Biological Process: protein transport; multicellular organismal development; gene expression; spermatogenesis; cell differentiation

Research Articles on TSNAX

Similar Products

Product Notes

The TSNAX tsnax (Catalog #AAA3216384) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSNAX antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TSNAX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TSNAX tsnax for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QHFIKTRSLI SMDEINKQLI FTTEDNGKEN KTPSSDAQDK QFGTWRLRVT. It is sometimes possible for the material contained within the vial of "TSNAX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.