Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FOLR2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellFOLR2 is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit FOLR2 Polyclonal Antibody | anti-FOLR2 antibody

FOLR2 Antibody - C-terminal region

Gene Names
FOLR2; FBP; FR-P3; FR-BETA; BETA-HFR; FBP/PL-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FOLR2; Polyclonal Antibody; FOLR2 Antibody - C-terminal region; anti-FOLR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNA
Sequence Length
272
Applicable Applications for anti-FOLR2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FOLR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FOLR2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellFOLR2 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-FOLR2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellFOLR2 is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-FOLR2 antibody
This is a rabbit polyclonal antibody against FOLR2. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene.
Product Categories/Family for anti-FOLR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
folate receptor beta
NCBI Official Synonym Full Names
folate receptor beta
NCBI Official Symbol
FOLR2
NCBI Official Synonym Symbols
FBP; FR-P3; FR-BETA; BETA-HFR; FBP/PL-1
NCBI Protein Information
folate receptor beta
UniProt Protein Name
Folate receptor beta
Protein Family
UniProt Gene Name
FOLR2
UniProt Synonym Gene Names
FR-beta; FBP

NCBI Description

The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

FOLR2: Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Belongs to the folate receptor family.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 11q13.4

Cellular Component: anchored to external side of plasma membrane; cell surface; membrane

Molecular Function: drug binding; folic acid binding; folic acid transporter activity; methotrexate binding

Biological Process: folic acid transport; monocyte chemotaxis; positive regulation of cell proliferation; receptor-mediated endocytosis; regulation of thymidylate synthase biosynthetic process

Research Articles on FOLR2

Similar Products

Product Notes

The FOLR2 folr2 (Catalog #AAA3216945) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOLR2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FOLR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FOLR2 folr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LCEGLWSHSY KVSNYSRGSG RCIQMWFDSA QGNPNEEVAR FYAAAMHVNA. It is sometimes possible for the material contained within the vial of "FOLR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.