Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Platelet Factor 4 (PF4) Recombinant Protein | PF4 recombinant protein

Recombinant Platelet Factor 4 (PF4)

Gene Names
Pf4; PF-4; Pf4a; Cxcl4; RATPF4A
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
Platelet Factor 4 (PF4); Recombinant Platelet Factor 4 (PF4); PF4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-V TRASPEESDG DLSCVCVKTS SSRIHLKRIT SLEVIKAGPH CAVPQLIATL KNGSKICLDR QVPLYKKIIK KLLES
Sequence Length
105
Applicable Applications for PF4 recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Rattus norvegicus (Rat)
Expression System
Prokaryotic expression
Residues
Val30~Ser105 (Accession # P06765) with two N-terminal Tags, His-tag and S-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14.0kDa
NCBI Official Full Name
platelet factor 4
NCBI Official Synonym Full Names
platelet factor 4
NCBI Official Symbol
Pf4
NCBI Official Synonym Symbols
PF-4; Pf4a; Cxcl4; RATPF4A
NCBI Protein Information
platelet factor 4; C-X-C motif chemokine 4; chemokine (C-X-C motif) ligand 4
UniProt Protein Name
Platelet factor 4
Protein Family
UniProt Gene Name
Pf4
UniProt Synonym Gene Names
Cxcl4; Scyb4; PF-4
UniProt Entry Name
PLF4_RAT

NCBI Description

member of low-molecular weight chemokines superfamily; may mediate inflammation and immune response [RGD, Feb 2006]

Uniprot Description

PF4: Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Chemokine; Secreted; Secreted, signal peptide; Apoptosis; Motility/polarity/chemotaxis

Cellular Component: extracellular space; protein complex; vesicle

Molecular Function: heparin binding; CXCR3 chemokine receptor binding; chemokine activity; CXCR chemokine receptor binding

Biological Process: negative regulation of cytolysis; platelet activation; cytokine and chemokine mediated signaling pathway; leukocyte chemotaxis; response to lipopolysaccharide; positive regulation of leukocyte chemotaxis; positive regulation of cAMP metabolic process; positive regulation of tumor necrosis factor production; negative regulation of megakaryocyte differentiation; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; negative regulation of angiogenesis; negative regulation of MHC class II biosynthetic process; immune response; protein complex assembly; positive regulation of transcription from RNA polymerase II promoter; inflammatory response; positive regulation of macrophage differentiation

Research Articles on PF4

Similar Products

Product Notes

The PF4 pf4 (Catalog #AAA2012069) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Platelet Factor 4 (PF4) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the PF4 pf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-V TRASPEESDG DLSCVCVKTS SSRIHLKRIT SLEVIKAGPH CAVPQLIATL KNGSKICLDR QVPLYKKIIK KLLES. It is sometimes possible for the material contained within the vial of "Platelet Factor 4 (PF4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.