Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable histone-lysine N-methyltransferase NSD2 (WHSC1) Recombinant Protein | WHSC1 recombinant protein

Recombinant Human Probable histone-lysine N-methyltransferase NSD2 (WHSC1) , partial

Gene Names
NSD2; WHS; TRX5; KMT3F; KMT3G; MMSET; WHSC1; REIIBP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable histone-lysine N-methyltransferase NSD2 (WHSC1); Recombinant Human Probable histone-lysine N-methyltransferase NSD2 (WHSC1); partial; WHSC1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
998-1299, Partial, include the SET domain and PHD-type 4 domain.
Sequence
KPYGKVQIYTADISEIPKCNCKPTDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSTTLSSEEKGKKTKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCTKAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHLC
Sequence Length
1299
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for WHSC1 recombinant protein
This gene encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene maps to the 165 kb WHS critical region and has also been involved in the chromosomal translocation t(4;14)(p16.3;q32.3) in multiple myelomas. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. Some transcript variants are nonsense-mediated mRNA (NMD) decay candidates, hence not represented as reference sequences.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,199 Da
NCBI Official Full Name
histone-lysine N-methyltransferase NSD2 isoform 1
NCBI Official Synonym Full Names
nuclear receptor binding SET domain protein 2
NCBI Official Symbol
NSD2
NCBI Official Synonym Symbols
WHS; TRX5; KMT3F; KMT3G; MMSET; WHSC1; REIIBP
NCBI Protein Information
histone-lysine N-methyltransferase NSD2
UniProt Protein Name
Histone-lysine N-methyltransferase NSD2
UniProt Gene Name
NSD2
UniProt Synonym Gene Names
MMSET

NCBI Description

This gene encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene maps to the 165 kb WHS critical region and has also been involved in the chromosomal translocation t(4;14)(p16.3;q32.3) in multiple myelomas. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. Some transcript variants are nonsense-mediated mRNA (NMD) decay candidates, hence not represented as reference sequences. [provided by RefSeq, Jul 2008]

Uniprot Description

Histone methyltransferase with histone H3 'Lys-27' (H3K27me) methyltransferase activity. Isoform 2 may act as a transcription regulator that binds DNA and suppresses IL5 transcription through HDAC recruitment.

Research Articles on WHSC1

Similar Products

Product Notes

The WHSC1 nsd2 (Catalog #AAA1081616) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 998-1299, Partial, include the SET domain and PHD-type 4 domain. The amino acid sequence is listed below: KPYGKVQIYT ADISEIPKCN CKPTDENPCG FDSECLNRML MFECHPQVCP AGEFCQNQCF TKRQYPETKI IKTDGKGWGL VAKRDIRKGE FVNEYVGELI DEEECMARIK HAHENDITHF YMLTIDKDRI IDAGPKGNYS RFMNHSCQPN CETLKWTVNG DTRVGLFAVC DIPAGTELTF NYNLDCLGNE KTVCRCGASN CSGFLGDRPK TSTTLSSEEK GKKTKKKTRR RRAKGEGKRQ SEDECFRCGD GGQLVLCDRK FCTKAYHLSC LGLGKRPFGK WECPWHHCDV CGKPSTSFCH LC . It is sometimes possible for the material contained within the vial of "Probable histone-lysine N-methyltransferase NSD2 (WHSC1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.