Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic Recombinant Protein | ndhG recombinant protein

Recombinant Populus trichocarpa NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NAD (P)H-quinone oxidoreductase subunit 6; chloroplastic; Recombinant Populus trichocarpa NAD (P)H-quinone oxidoreductase subunit 6; Recombinant NAD (P)H-quinone oxidoreductase subunit 6; NAD(P)H-quinone oxidoreductase subunit 6; chloroplastic EC= 1.6.5.-; NAD(P)H dehydrogenase subunit 6 NADH-plastoquinone oxidoreductase subunit 6; ndhG recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-176
Sequence
MNLPGPIHDFLLVFLGLGLILGGLGVVLLTNPIFSAFSLGLVLVCISLFYILSNSHFVAAAQLLIYVGAINVLILFAVMFMNGSEYYKDFNLWTVGNGLTSLICTSLFVLLITIISNTTWYGIIWTTRANQIIEQDLVSNGQQIGIHLSTDFFLPFEFISIILLVALIGAIATARQ
Sequence Length
176
Species
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,245 Da
NCBI Official Full Name
NADH dehydrogenase subunit 6
NCBI Official Symbol
ndhG
NCBI Protein Information
NADH dehydrogenase subunit 6
UniProt Protein Name
NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic
UniProt Gene Name
ndhG
UniProt Entry Name
NU6C_POPTR

Uniprot Description

Function: NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient

By similarity.

Catalytic activity: NAD(P)H + plastoquinone = NAD(P)+ + plastoquinol.

Subunit structure: NDH is composed of at least 16 different subunits, 5 of which are encoded in the nucleus

By similarity.

Subcellular location: Plastid › chloroplast thylakoid membrane; Multi-pass membrane protein

By similarity.

Sequence similarities: Belongs to the complex I subunit 6 family.

Similar Products

Product Notes

The ndhG ndhg (Catalog #AAA1248930) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-176. The amino acid sequence is listed below: MNLPGPIHDF LLVFLGLGLI LGGLGVVLLT NPIFSAFSLG LVLVCISLFY ILSNSHFVAA AQLLIYVGAI NVLILFAVMF MNGSEYYKDF NLWTVGNGLT SLICTSLFVL LITIISNTTW YGIIWTTRAN QIIEQDLVSN GQQIGIHLST DFFLPFEFIS IILLVALIGA IATARQ. It is sometimes possible for the material contained within the vial of "NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.