Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RAB1A blocking peptide

RAB1A Peptide - middle region

Gene Names
Rab1a; Gtbp; Rab1; Ypt1; Rab-1; mKIAA3012
Reactivity
Mouse
Synonyms
RAB1A; RAB1A Peptide - middle region; RAB1A blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTT
Sequence Length
205
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RAB1A blocking peptide
This is a synthetic peptide designed for use in combination with anti- RAB1A Antibody, made

Target Description: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB1A regulates vesicular protein transport from the endoplasmic reticulum (ER) to the Golgi compartment and on to the cell surface, and plays a role in IL-8 and growth hormone secretion. Regulates the level of CASR present at the cell membrane. Plays a role in cell adhesion and cell migration, via its role in protein trafficking. Plays a role in autophagosome assembly and cellular defense reactions against pathogenic bacteria (By similarity). Plays a role in microtubule-dependent protein transport by early endosomes and in anterograde melanosome transport.
Product Categories/Family for RAB1A blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23 kDa
NCBI Official Full Name
ras-related protein Rab-1A
NCBI Official Synonym Full Names
RAB1A, member RAS oncogene family
NCBI Official Symbol
Rab1a
NCBI Official Synonym Symbols
Gtbp; Rab1; Ypt1; Rab-1; mKIAA3012
NCBI Protein Information
ras-related protein Rab-1A
UniProt Protein Name
Ras-related protein Rab-1A
Protein Family
UniProt Gene Name
Rab1A
UniProt Synonym Gene Names
Rab1
UniProt Entry Name
RAB1A_MOUSE

Uniprot Description

RAB1A: Probably required for transit of protein from the ER through Golgi compartment. Binds GTP and GDP and possesses intrinsic GTPase activity. Belongs to the small GTPase superfamily. Rab family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein; G protein, monomeric, Rab; G protein, monomeric

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; cell soma; membrane; endoplasmic reticulum; cell; cytoplasm; early endosome; melanosome; intracellular; endosome

Molecular Function: GTPase activity; protein binding; GTP binding; nucleotide binding

Biological Process: ER to Golgi vesicle-mediated transport; cell migration; endocytosis; virus assembly; melanosome transport; vesicle-mediated transport; growth hormone secretion; intracellular protein transport; protein transport; transport; small GTPase mediated signal transduction; defense response to bacterium; vesicle transport along microtubule; autophagy; Rab protein signal transduction; Golgi organization and biogenesis; autophagic vacuole formation

Research Articles on RAB1A

Similar Products

Product Notes

The RAB1A rab1a (Catalog #AAA3248320) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RAB1A Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: VVYDVTDQES FNNVKQWLQE IDRYASENVN KLLVGNKCDL TTKKVVDYTT. It is sometimes possible for the material contained within the vial of "RAB1A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.