Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of YWHAZ expression in transfected 293T cell line by YWHAZ monoclonal antibody (M12), clone 5E8.Lane 1: YWHAZ transfected lysate (Predicted MW: 27.7 KDa).Lane 2: Non-transfected lysate.)

Mouse YWHAZ Monoclonal Antibody | anti-YWHAZ antibody

YWHAZ (Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide, KCIP-1, MGC111427, MGC126532, MGC138156) (Biotin)

Gene Names
YWHAZ; HEL4; YWHAD; KCIP-1; HEL-S-3; 14-3-3-zeta
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
YWHAZ; Monoclonal Antibody; YWHAZ (Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; zeta Polypeptide; KCIP-1; MGC111427; MGC126532; MGC138156) (Biotin); Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; MGC138156; anti-YWHAZ antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
500000000
Specificity
Recognizes YWHAZ.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-YWHAZ antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
YWHAZ (NP_003397.1, 1aa-245aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of YWHAZ expression in transfected 293T cell line by YWHAZ monoclonal antibody (M12), clone 5E8.Lane 1: YWHAZ transfected lysate (Predicted MW: 27.7 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of YWHAZ expression in transfected 293T cell line by YWHAZ monoclonal antibody (M12), clone 5E8.Lane 1: YWHAZ transfected lysate (Predicted MW: 27.7 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-YWHAZ antibody
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq]
Product Categories/Family for anti-YWHAZ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19,333 Da
NCBI Official Full Name
14-3-3 protein zeta/delta
NCBI Official Synonym Full Names
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
NCBI Official Symbol
YWHAZ
NCBI Official Synonym Symbols
HEL4; YWHAD; KCIP-1; HEL-S-3; 14-3-3-zeta
NCBI Protein Information
14-3-3 protein zeta/delta; 14-3-3 zeta; 14-3-3 delta; phospholipase A2; epididymis luminal protein 4; epididymis secretory protein Li 3; protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; 14-3-3 protein/cytosolic phospholipase A2;
UniProt Protein Name
14-3-3 protein zeta/delta
Protein Family
UniProt Gene Name
YWHAZ
UniProt Synonym Gene Names
KCIP-1
UniProt Entry Name
1433Z_HUMAN

NCBI Description

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

14-3-3 zeta: a protein of the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. A multifunctional regulator of the cell signaling processes. Phosphorylation apparently disrupts homodimerization.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 8q23.1

Cellular Component: extracellular space; protein complex; mast cell granule; cytoplasmic vesicle membrane; focal adhesion; mitochondrion; postsynaptic density; leading edge; cytosol; nucleoplasm; perinuclear region of cytoplasm; cytoplasm; melanosome; nucleus

Molecular Function: identical protein binding; protein domain specific binding; protein binding; protein complex binding; protein kinase binding; transcription factor binding

Biological Process: response to drug; platelet activation; histamine secretion by mast cell; establishment of Golgi localization; apoptosis; gene expression; signal transduction; blood coagulation; protein targeting to mitochondrion; negative regulation of apoptosis

Research Articles on YWHAZ

Similar Products

Product Notes

The YWHAZ ywhaz (Catalog #AAA6174388) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's YWHAZ can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the YWHAZ ywhaz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "YWHAZ, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.