Mouse YWHAZ Monoclonal Antibody | anti-YWHAZ antibody

YWHAZ (Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein, zeta Polypeptide, KCIP-1, MGC111427, MGC126532, MGC138156) (PE)

Cat. Num. AAA6187618

• Gene Names: YWHAZ; HEL4; YWHAD; KCIP-1; HEL-S-3; 14-3-3-zeta
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: YWHAZ; Monoclonal Antibody; YWHAZ (Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; zeta Polypeptide; KCIP-1; MGC111427; MGC126532; MGC138156) (PE); Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; MGC138156; anti-YWHAZ antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 500000000
• Specificity: Recognizes YWHAZ.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-YWHAZ antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: YWHAZ (NP_003397.1, 1aa-245aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of YWHAZ expression in transfected 293T cell line by YWHAZ monoclonal antibody (M12), clone 5E8.Lane 1: YWHAZ transfected lysate (Predicted MW: 27.7 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-YWHAZ antibody

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq]

Product Categories/Family for anti-YWHAZ antibody

Antibodies; 14-3-3

NCBI and Uniprot Product Information

• NCBI GI #: 4507953
• NCBI GeneID: 7534
• NCBI Accession #: NP_003397.1
• NCBI GenBank Nucleotide #: NM_003406.3
• UniProt Accession #: P63104; P29213; P29312; Q32P43; Q5XJ08; Q6GPI2; Q6IN74; Q6NUR9; Q6P3U9; Q86V33; A8K1N0; B7Z465
• Molecular Weight: 19,333 Da
• NCBI Official Full Name: 14-3-3 protein zeta/delta
• NCBI Official Synonym Full Names: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
• NCBI Official Symbol: YWHAZ
• NCBI Official Synonym Symbols: HEL4; YWHAD; KCIP-1; HEL-S-3; 14-3-3-zeta
• NCBI Protein Information: 14-3-3 protein zeta/delta; 14-3-3 zeta; 14-3-3 delta; phospholipase A2; epididymis luminal protein 4; epididymis secretory protein Li 3; protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; 14-3-3 protein/cytosolic phospholipase A2
• UniProt Protein Name: 14-3-3 protein zeta/delta
• Protein Family: 14-3-3 protein
• UniProt Gene Name: YWHAZ
• UniProt Synonym Gene Names: KCIP-1
• UniProt Entry Name: 1433Z_HUMAN

NCBI Description

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

14-3-3 zeta: a protein of the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. A multifunctional regulator of the cell signaling processes. Phosphorylation apparently disrupts homodimerization.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 8q23.1

Cellular Component: extracellular space; protein complex; mast cell granule; cytoplasmic vesicle membrane; focal adhesion; mitochondrion; postsynaptic density; leading edge; cytosol; nucleoplasm; perinuclear region of cytoplasm; cytoplasm; melanosome; nucleus

Molecular Function: identical protein binding; protein domain specific binding; protein binding; protein complex binding; protein kinase binding; transcription factor binding

Biological Process: response to drug; platelet activation; histamine secretion by mast cell; establishment of Golgi localization; apoptosis; gene expression; signal transduction; blood coagulation; protein targeting to mitochondrion; negative regulation of apoptosis