Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged UROD is approximately 0.1ng/ml as a capture antibody.)

Mouse UROD Monoclonal Antibody | anti-UROD antibody

UROD (Uroporphyrinogen Decarboxylase, PCT) (AP)

Gene Names
UROD; PCT; UPD
Applications
Western Blot
Purity
Purified
Synonyms
UROD; Monoclonal Antibody; UROD (Uroporphyrinogen Decarboxylase; PCT) (AP); Uroporphyrinogen Decarboxylase; PCT; anti-UROD antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F5
Specificity
Recognizes UROD.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-UROD antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
UROD (NP_000365, 268aa-367aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged UROD is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UROD is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-UROD antibody
This gene encodes the fifth enzyme of the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria. [provided by RefSeq]
Product Categories/Family for anti-UROD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,787 Da
NCBI Official Full Name
uroporphyrinogen decarboxylase
NCBI Official Synonym Full Names
uroporphyrinogen decarboxylase
NCBI Official Symbol
UROD
NCBI Official Synonym Symbols
PCT; UPD
NCBI Protein Information
uroporphyrinogen decarboxylase; uroporphyrinogen III decarboxylase
UniProt Protein Name
Uroporphyrinogen decarboxylase
UniProt Gene Name
UROD
UniProt Synonym Gene Names
UPD; URO-D
UniProt Entry Name
DCUP_HUMAN

Uniprot Description

UROD: Catalyzes the decarboxylation of four acetate groups of uroporphyrinogen-III to yield coproporphyrinogen-III. Defects in UROD are the cause of familial porphyria cutanea tarda (FPCT); also known as porphyria cutanea tarda type II. FPCT is an autosomal dominant disorder characterized by light-sensitive dermatitis, with onset in later life. It is associated with the excretion of large amounts of uroporphyrin in the urine. Iron overload is often present in association with varying degrees of liver damage. Besides the familial form of PCT, a relatively common idiosyncratic form is known in which only the liver enzyme is reduced. This form is referred to as porphyria cutanea tarda sporadic type or type I. PCT type I occurs sporadically as an unusual accompaniment of common hepatic disorders such as alcohol- associated liver disease. Defects in UROD are the cause of hepatoerythropoietic porphyria (HEP). HEP is a rare autosomal recessive disorder. It is the severe form of cutaneous porphyria, and presents in infancy. The level of UROD is very low in erythrocytes and cultured skin fibroblasts, suggesting that HEP is the homozygous state for porphyria cutanea tarda. Belongs to the uroporphyrinogen decarboxylase family.

Protein type: Cofactor and Vitamin Metabolism - porphyrin and chlorophyll; EC 4.1.1.37; Lyase

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function: uroporphyrinogen decarboxylase activity

Biological Process: porphyrin metabolic process; protoporphyrinogen IX biosynthetic process; heme biosynthetic process

Disease: Porphyria Cutanea Tarda

Similar Products

Product Notes

The UROD urod (Catalog #AAA6163767) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's UROD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UROD urod for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UROD, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.