Mouse UROD Monoclonal Antibody | anti-UROD antibody

UROD (Uroporphyrinogen Decarboxylase, PCT) (APC)

Cat. Num. AAA6168177

• Gene Names: UROD; PCT; UPD
• Applications: Western Blot
• Purity: Purified
• Synonyms: UROD; Monoclonal Antibody; UROD (Uroporphyrinogen Decarboxylase; PCT) (APC); Uroporphyrinogen Decarboxylase; PCT; anti-UROD antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F5
• Specificity: Recognizes UROD.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-UROD antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: UROD (NP_000365, 268aa-367aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged UROD is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-UROD antibody

This gene encodes the fifth enzyme of the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria. [provided by RefSeq]

Product Categories/Family for anti-UROD antibody

Antibodies; Enzymes; Decarboxylase

NCBI and Uniprot Product Information

• NCBI GI #: 71051616
• NCBI GeneID: 7389
• NCBI Accession #: NP_000365
• NCBI GenBank Nucleotide #: NM_000374
• UniProt Accession #: P06132; Q16863; Q16883; Q53YB8; Q53ZP6; Q6IB28; Q9BUZ0; A8K762
• Molecular Weight: 40,787 Da
• NCBI Official Full Name: uroporphyrinogen decarboxylase
• NCBI Official Synonym Full Names: uroporphyrinogen decarboxylase
• NCBI Official Symbol: UROD
• NCBI Official Synonym Symbols: PCT; UPD
• NCBI Protein Information: uroporphyrinogen decarboxylase; uroporphyrinogen III decarboxylase
• UniProt Protein Name: Uroporphyrinogen decarboxylase
• UniProt Gene Name: UROD
• UniProt Synonym Gene Names: UPD; URO-D
• UniProt Entry Name: DCUP_HUMAN

Uniprot Description

UROD: Catalyzes the decarboxylation of four acetate groups of uroporphyrinogen-III to yield coproporphyrinogen-III. Defects in UROD are the cause of familial porphyria cutanea tarda (FPCT); also known as porphyria cutanea tarda type II. FPCT is an autosomal dominant disorder characterized by light-sensitive dermatitis, with onset in later life. It is associated with the excretion of large amounts of uroporphyrin in the urine. Iron overload is often present in association with varying degrees of liver damage. Besides the familial form of PCT, a relatively common idiosyncratic form is known in which only the liver enzyme is reduced. This form is referred to as porphyria cutanea tarda sporadic type or type I. PCT type I occurs sporadically as an unusual accompaniment of common hepatic disorders such as alcohol- associated liver disease. Defects in UROD are the cause of hepatoerythropoietic porphyria (HEP). HEP is a rare autosomal recessive disorder. It is the severe form of cutaneous porphyria, and presents in infancy. The level of UROD is very low in erythrocytes and cultured skin fibroblasts, suggesting that HEP is the homozygous state for porphyria cutanea tarda. Belongs to the uroporphyrinogen decarboxylase family.

Protein type: Cofactor and Vitamin Metabolism - porphyrin and chlorophyll; EC 4.1.1.37; Lyase

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function: uroporphyrinogen decarboxylase activity

Biological Process: porphyrin metabolic process; protoporphyrinogen IX biosynthetic process; heme biosynthetic process

Disease: Porphyria Cutanea Tarda