Rabbit anti-Human NDUFA1 Polyclonal Antibody | anti-NDUFA1 antibody

NDUFA1 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 1, Complex I-MWFE, CI-MWFE, NADH-ubiquinone Oxidoreductase MWFE Subunit) (HRP)

Cat. Num. AAA6386615

• Gene Names: NDUFA1; MWFE; ZNF183; CI-MWFE; MC1DN12
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NDUFA1; Polyclonal Antibody; NDUFA1 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 1; Complex I-MWFE; CI-MWFE; NADH-ubiquinone Oxidoreductase MWFE Subunit) (HRP); anti-NDUFA1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NDUFA1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
• Sequence Length: 70

• Applicable Applications for anti-NDUFA1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human NDUFA1, aa1-70 (AAH00266.1).
• Immunogen Sequence: MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NDUFA1 expression in transfected 293T cell line by NDUFA1 polyclonal antibody. Lane 1: NDUFA1 transfected lysate (8.1kD). Lane 2: Non-transfected lysate)

Related Product Information for anti-NDUFA1 antibody

NDUFA1 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1) is an essential component of the multisubunit NADH ubiquinone oxidoreductase (complex 1), the first enzyme complex in the mitochondrial respiratory chain. Complex I transfers electrons from NADH to the respiratory chain via ubiquinone.

Product Categories/Family for anti-NDUFA1 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 12653011
• NCBI GeneID: 4694
• NCBI Accession #: AAH00266.1
• NCBI GenBank Nucleotide #: NM_004541.2
• UniProt Accession #: O15239
• NCBI Official Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
• NCBI Official Synonym Full Names: NADH:ubiquinone oxidoreductase subunit A1
• NCBI Official Symbol: NDUFA1
• NCBI Official Synonym Symbols: MWFE; ZNF183; CI-MWFE; MC1DN12
• NCBI Protein Information: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
• UniProt Protein Name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
• UniProt Gene Name: NDUFA1
• UniProt Synonym Gene Names: CI-MWFE
• UniProt Entry Name: NDUA1_HUMAN

NCBI Description

The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq, Jul 2008]

Uniprot Description

NDUFA1: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Defects in NDUFA1 are a cause of mitochondrial complex I deficiency (MT-C1D). A disorder of the mitochondrial respiratory chain that causes a wide range of clinical disorders, from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease. Belongs to the complex I NDUFA1 subunit family.

Protein type: Oxidoreductase; Mitochondrial; EC 1.6.5.3; Membrane protein, integral; Energy Metabolism - oxidative phosphorylation; EC 1.6.99.3

Chromosomal Location of Human Ortholog: Xq24

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial membrane; integral to membrane; mitochondrial respiratory chain complex I

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone

Disease: Mitochondrial Complex I Deficiency