Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NDUFA1 expression in transfected 293T cell line by NDUFA1 polyclonal antibody. Lane 1: NDUFA1 transfected lysate (8.1kD). Lane 2: Non-transfected lysate)

Rabbit anti-Human NDUFA1 Polyclonal Antibody | anti-NDUFA1 antibody

NDUFA1 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 1, Complex I-MWFE, CI-MWFE, NADH-ubiquinone Oxidoreductase MWFE Subunit) (HRP)

Gene Names
NDUFA1; MWFE; ZNF183; CI-MWFE; MC1DN12
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NDUFA1; Polyclonal Antibody; NDUFA1 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 1; Complex I-MWFE; CI-MWFE; NADH-ubiquinone Oxidoreductase MWFE Subunit) (HRP); anti-NDUFA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NDUFA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
70
Applicable Applications for anti-NDUFA1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NDUFA1, aa1-70 (AAH00266.1).
Immunogen Sequence
MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NDUFA1 expression in transfected 293T cell line by NDUFA1 polyclonal antibody. Lane 1: NDUFA1 transfected lysate (8.1kD). Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of NDUFA1 expression in transfected 293T cell line by NDUFA1 polyclonal antibody. Lane 1: NDUFA1 transfected lysate (8.1kD). Lane 2: Non-transfected lysate)
Related Product Information for anti-NDUFA1 antibody
NDUFA1 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1) is an essential component of the multisubunit NADH ubiquinone oxidoreductase (complex 1), the first enzyme complex in the mitochondrial respiratory chain. Complex I transfers electrons from NADH to the respiratory chain via ubiquinone.
Product Categories/Family for anti-NDUFA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit A1
NCBI Official Symbol
NDUFA1
NCBI Official Synonym Symbols
MWFE; ZNF183; CI-MWFE; MC1DN12
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
UniProt Gene Name
NDUFA1
UniProt Synonym Gene Names
CI-MWFE
UniProt Entry Name
NDUA1_HUMAN

NCBI Description

The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq, Jul 2008]

Uniprot Description

NDUFA1: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Defects in NDUFA1 are a cause of mitochondrial complex I deficiency (MT-C1D). A disorder of the mitochondrial respiratory chain that causes a wide range of clinical disorders, from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease. Belongs to the complex I NDUFA1 subunit family.

Protein type: Oxidoreductase; Mitochondrial; EC 1.6.5.3; Membrane protein, integral; Energy Metabolism - oxidative phosphorylation; EC 1.6.99.3

Chromosomal Location of Human Ortholog: Xq24

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial membrane; integral to membrane; mitochondrial respiratory chain complex I

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone

Disease: Mitochondrial Complex I Deficiency

Research Articles on NDUFA1

Similar Products

Product Notes

The NDUFA1 ndufa1 (Catalog #AAA6386615) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFA1 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 1, Complex I-MWFE, CI-MWFE, NADH-ubiquinone Oxidoreductase MWFE Subunit) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDUFA1 ndufa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDUFA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.