Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse TRPV1 Monoclonal Antibody | anti-TRPV1 antibody

TRPV1 (Transient Receptor Potential Cation Channel, Subfamily V, Member 1, DKFZp434K0220, VR1) (MaxLight 490)

Gene Names
TRPV1; VR1
Applications
Western Blot
Purity
Purified
Synonyms
TRPV1; Monoclonal Antibody; TRPV1 (Transient Receptor Potential Cation Channel; Subfamily V; Member 1; DKFZp434K0220; VR1) (MaxLight 490); Transient Receptor Potential Cation Channel; VR1; anti-TRPV1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A8
Specificity
Recognizes TRPV1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-TRPV1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TRPV1 (NP_542437, 21aa-124aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TRPV1 antibody
Capsaicin, the main pungent ingredient in hot chili peppers, elicits a sensation of burning pain by selectively activating sensory neurons that convey information about noxious stimuli to the central nervous system. The protein encoded by this gene is a receptor for capsaicin and is a non-selective cation channel that is structurally related to members of the TRP family of ion channels. This receptor is also activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo. Four transcript variants encoding the same protein, but with different 5' UTR sequence, have been described for this gene. [provided by RefSeq]
Product Categories/Family for anti-TRPV1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 92 kDa
NCBI Official Full Name
transient receptor potential cation channel subfamily V member 1
NCBI Official Synonym Full Names
transient receptor potential cation channel, subfamily V, member 1
NCBI Official Symbol
TRPV1
NCBI Official Synonym Symbols
VR1
NCBI Protein Information
transient receptor potential cation channel subfamily V member 1; OTRPC1; capsaicin receptor; osm-9-like TRP channel 1; vanilloid receptor subtype 1; transient receptor potential vanilloid 1a; transient receptor potential vanilloid 1b
UniProt Protein Name
Transient receptor potential cation channel subfamily V member 1
UniProt Gene Name
TRPV1
UniProt Synonym Gene Names
VR1; TrpV1; OTRPC1
UniProt Entry Name
TRPV1_HUMAN

NCBI Description

Capsaicin, the main pungent ingredient in hot chili peppers, elicits a sensation of burning pain by selectively activating sensory neurons that convey information about noxious stimuli to the central nervous system. The protein encoded by this gene is a receptor for capsaicin and is a non-selective cation channel that is structurally related to members of the TRP family of ion channels. This receptor is also activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo. Four transcript variants encoding the same protein, but with different 5' UTR sequence, have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

TRPV1: a receptor for capsaicin and a non-selective cation channel that is structurally related to members of the TRP family of ion channels. Activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo.

Protein type: Channel, cation; Membrane protein, multi-pass; Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 17p13.2

Cellular Component: postsynaptic membrane; integral to plasma membrane; integral to membrane; plasma membrane; cell junction; intrinsic to plasma membrane

Molecular Function: calmodulin binding; transmembrane receptor activity; excitatory extracellular ligand-gated ion channel activity; calcium-release channel activity; calcium channel activity; phosphoprotein binding; ATP binding

Biological Process: cell surface receptor linked signal transduction; transport; chemosensory behavior; thermoception; transmembrane transport

Research Articles on TRPV1

Similar Products

Product Notes

The TRPV1 trpv1 (Catalog #AAA6209159) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TRPV1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRPV1 trpv1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRPV1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.