Mouse TRPV1 Monoclonal Antibody | anti-TRPV1 antibody

TRPV1 (Transient Receptor Potential Cation Channel, Subfamily V, Member 1, DKFZp434K0220, VR1) (PE)

Cat. Num. AAA6187167

• Gene Names: TRPV1; VR1
• Applications: Western Blot
• Purity: Purified
• Synonyms: TRPV1; Monoclonal Antibody; TRPV1 (Transient Receptor Potential Cation Channel; Subfamily V; Member 1; DKFZp434K0220; VR1) (PE); Transient Receptor Potential Cation Channel; VR1; anti-TRPV1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A8
• Specificity: Recognizes TRPV1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-TRPV1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TRPV1 (NP_542437, 21aa-124aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TRPV1 is 0.03 ng/ml as a capture antibody.)

Western Blot (WB)

(TRPV1 monoclonal antibody (M02), clone 1A8. Western Blot analysis of TRPV1 expression in rat thymus.)

Related Product Information for anti-TRPV1 antibody

Capsaicin, the main pungent ingredient in hot chili peppers, elicits a sensation of burning pain by selectively activating sensory neurons that convey information about noxious stimuli to the central nervous system. The protein encoded by this gene is a receptor for capsaicin and is a non-selective cation channel that is structurally related to members of the TRP family of ion channels. This receptor is also activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo. Four transcript variants encoding the same protein, but with different 5' UTR sequence, have been described for this gene. [provided by RefSeq]

Product Categories/Family for anti-TRPV1 antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 74315354
• NCBI GeneID: 7442
• NCBI Accession #: NP_542437
• NCBI GenBank Nucleotide #: NM_080706.3
• UniProt Accession #: Q8NER1; Q3LU47; Q9H0G9; Q9H303; Q9H304; Q9NQ74; Q9NY22; A2RUA9
• Molecular Weight: Predicted: 92 kDa
• NCBI Official Full Name: transient receptor potential cation channel subfamily V member 1
• NCBI Official Synonym Full Names: transient receptor potential cation channel, subfamily V, member 1
• NCBI Official Symbol: TRPV1
• NCBI Official Synonym Symbols: VR1
• NCBI Protein Information: transient receptor potential cation channel subfamily V member 1; OTRPC1; capsaicin receptor; osm-9-like TRP channel 1; vanilloid receptor subtype 1; transient receptor potential vanilloid 1a; transient receptor potential vanilloid 1b
• UniProt Protein Name: Transient receptor potential cation channel subfamily V member 1
• Protein Family: Transient receptor potential cation channel subfamily
• UniProt Gene Name: TRPV1
• UniProt Synonym Gene Names: VR1; TrpV1; OTRPC1
• UniProt Entry Name: TRPV1_HUMAN

NCBI Description

Capsaicin, the main pungent ingredient in hot chili peppers, elicits a sensation of burning pain by selectively activating sensory neurons that convey information about noxious stimuli to the central nervous system. The protein encoded by this gene is a receptor for capsaicin and is a non-selective cation channel that is structurally related to members of the TRP family of ion channels. This receptor is also activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo. Four transcript variants encoding the same protein, but with different 5' UTR sequence, have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

TRPV1: a receptor for capsaicin and a non-selective cation channel that is structurally related to members of the TRP family of ion channels. Activated by increases in temperature in the noxious range, suggesting that it functions as a transducer of painful thermal stimuli in vivo.

Protein type: Channel, cation; Membrane protein, multi-pass; Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 17p13.2

Cellular Component: postsynaptic membrane; integral to plasma membrane; integral to membrane; plasma membrane; cell junction; intrinsic to plasma membrane

Molecular Function: calmodulin binding; transmembrane receptor activity; excitatory extracellular ligand-gated ion channel activity; calcium-release channel activity; calcium channel activity; phosphoprotein binding; ATP binding

Biological Process: cell surface receptor linked signal transduction; transport; chemosensory behavior; thermoception; transmembrane transport