Mouse TIMP2 Monoclonal Antibody | anti-TIMP2 antibody

TIMP2 (TIMP Metallopeptidase Inhibitor 2, CSC-21K) (PE)

Cat. Num. AAA6187474

• Gene Names: TIMP2; DDC8; CSC-21K
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: TIMP2; Monoclonal Antibody; TIMP2 (TIMP Metallopeptidase Inhibitor 2; CSC-21K) (PE); TIMP Metallopeptidase Inhibitor 2; CSC-21K; anti-TIMP2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5D7
• Specificity: Recognizes TIMP2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 220

• Applicable Applications for anti-TIMP2 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TIMP2 (AAH52605, 27aa-220aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TIMP2 monoclonal antibody (M01), clone 5D7 Western Blot analysis of TIMP2 expression in HeLa (Cat # L013V1).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TIMP2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TIMP2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TIMP2 is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-TIMP2 antibody

This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. [provided by RefSeq]

Product Categories/Family for anti-TIMP2 antibody

Antibodies; Matrix Metalloproteinases

NCBI and Uniprot Product Information

• NCBI GI #: 30851688
• NCBI GeneID: 7077
• NCBI Official Full Name: TIMP metallopeptidase inhibitor 2
• NCBI Official Synonym Full Names: TIMP metallopeptidase inhibitor 2
• NCBI Official Symbol: TIMP2
• NCBI Official Synonym Symbols: DDC8; CSC-21K
• NCBI Protein Information: metalloproteinase inhibitor 2
• Protein Family: Metalloproteinase inhibitor

NCBI Description

This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. [provided by RefSeq, Jul 2008]