Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to SUMO1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Mouse anti-Human SUMO1 Monoclonal Antibody | anti-SUMO1 antibody

SUMO1 (Small Ubiquitin-related Modifier 1, SUMO-1, GAP-modifying Protein 1, GMP1, Sentrin, SMT3 Homolog 3, SMT3H3, Ubiquitin-homology Domain Protein PIC1, PIC1, Ubiquitin-like Protein SMT3C, Smt3C, Ubiquitin-like Protein UBL1, UBL1) APC

Gene Names
SUMO1; DAP1; GMP1; PIC1; SMT3; UBL1; OFC10; SENP2; SMT3C; SMT3H3
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SUMO1; Monoclonal Antibody; SUMO1 (Small Ubiquitin-related Modifier 1; SUMO-1; GAP-modifying Protein 1; GMP1; Sentrin; SMT3 Homolog 3; SMT3H3; Ubiquitin-homology Domain Protein PIC1; PIC1; Ubiquitin-like Protein SMT3C; Smt3C; Ubiquitin-like Protein UBL1; UBL1) APC; DAP1; OFC10; OK/SW-cl.43; SENP2; SMT3; anti-SUMO1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D7
Specificity
Recognizes human SUMO1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SUMO1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-101 from human SUMO1 (NP_001005781) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to SUMO1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to SUMO1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SUMO1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SUMO1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SUMO1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SUMO1 is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-SUMO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,557 Da
NCBI Official Full Name
small ubiquitin-related modifier 1 isoform a
NCBI Official Synonym Full Names
small ubiquitin-like modifier 1
NCBI Official Symbol
SUMO1
NCBI Official Synonym Symbols
DAP1; GMP1; PIC1; SMT3; UBL1; OFC10; SENP2; SMT3C; SMT3H3
NCBI Protein Information
small ubiquitin-related modifier 1; sentrin; SMT3 homolog 3; GAP modifying protein 1; ubiquitin-like protein UBL1; ubiquitin-like protein SMT3C; SMT3 suppressor of mif two 3 homolog 1; ubiquitin-homology domain protein PIC1
UniProt Protein Name
Small ubiquitin-related modifier 1
UniProt Gene Name
SUMO1
UniProt Synonym Gene Names
SMT3C; SMT3H3; UBL1; SUMO-1; GMP1; Smt3C
UniProt Entry Name
SUMO1_HUMAN

NCBI Description

This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene. Alternate transcriptional splice variants encoding different isoforms have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

SUMO1: Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. May also regulate a network of genes involved in palate development. Interacts with SAE2, UBE2I, RANBP2, PIAS1 and PIAS2. Interacts with PARK2. Covalently attached to a number of proteins such as IKFZ1, PML, RANGAP1, HIPK2, SP100, p53, p73-alpha, MDM2, JUN, DNMT3B and TDG. Also interacts with HIF1A, HIPK2, HIPK3, CHD3, EXOSC9, RAD51 and RAD52. Interacts with USP25 (via ts SIM domain); the interaction weakly sumoylates USP25. Belongs to the ubiquitin family. SUMO subfamily.

Protein type: Nuclear receptor co-regulator; Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 2q33

Cellular Component: nucleoplasm; PML body; nuclear membrane; cytoplasm; dendrite; fibrillar center; nucleolus; nuclear speck; synapse; nuclear pore; nucleus

Molecular Function: protein binding; ubiquitin protein ligase binding; transcription factor binding; SUMO ligase activity

Biological Process: negative regulation of transcription factor activity; cytokine and chemokine mediated signaling pathway; PML body organization and biogenesis; palate development; DNA repair; post-translational protein modification; negative regulation of DNA binding; positive regulation of protein complex assembly; protein sumoylation; regulation of protein localization; cellular protein metabolic process; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; negative regulation of transcription, DNA-dependent

Disease: Orofacial Cleft 10

Research Articles on SUMO1

Similar Products

Product Notes

The SUMO1 sumo1 (Catalog #AAA6139371) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SUMO1 (Small Ubiquitin-related Modifier 1, SUMO-1, GAP-modifying Protein 1, GMP1, Sentrin, SMT3 Homolog 3, SMT3H3, Ubiquitin-homology Domain Protein PIC1, PIC1, Ubiquitin-like Protein SMT3C, Smt3C, Ubiquitin-like Protein UBL1, UBL1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SUMO1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SUMO1 sumo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SUMO1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.