Mouse anti-Human SUMO1 Monoclonal Antibody | anti-SUMO1 antibody

SUMO1 (Small Ubiquitin-related Modifier 1, SUMO-1, GAP-modifying Protein 1, GMP1, Sentrin, SMT3 Homolog 3, SMT3H3, Ubiquitin-homology Domain Protein PIC1, PIC1, Ubiquitin-like Protein SMT3C, Smt3C, Ubiquitin-like Protein UBL1, UBL1) (PE)

Cat. Num. AAA6160583

• Gene Names: SUMO1; DAP1; GMP1; PIC1; SMT3; UBL1; OFC10; SENP2; SMT3C; SMT3H3
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SUMO1; Monoclonal Antibody; SUMO1 (Small Ubiquitin-related Modifier 1; SUMO-1; GAP-modifying Protein 1; GMP1; Sentrin; SMT3 Homolog 3; SMT3H3; Ubiquitin-homology Domain Protein PIC1; PIC1; Ubiquitin-like Protein SMT3C; Smt3C; Ubiquitin-like Protein UBL1; UBL1) (PE); DAP1; OFC10; OK/SW-cl.43; SENP2; SMT3; anti-SUMO1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3D7
• Specificity: Recognizes human SUMO1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-SUMO1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-101 from human SUMO1 (NP_001005781) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to SUMO1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SUMO1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SUMO1 is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-SUMO1 antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 54792065
• NCBI GeneID: 7341
• NCBI Accession #: NP_001005781.1
• NCBI GenBank Nucleotide #: NM_001005781
• UniProt Accession #: P63165; P55856; Q6FGG0; Q6NZ62; Q93068; B2R4I5
• Molecular Weight: 11,557 Da
• NCBI Official Full Name: small ubiquitin-related modifier 1 isoform a
• NCBI Official Synonym Full Names: small ubiquitin-like modifier 1
• NCBI Official Symbol: SUMO1
• NCBI Official Synonym Symbols: DAP1; GMP1; PIC1; SMT3; UBL1; OFC10; SENP2; SMT3C; SMT3H3
• NCBI Protein Information: small ubiquitin-related modifier 1; sentrin; SMT3 homolog 3; GAP modifying protein 1; ubiquitin-like protein UBL1; ubiquitin-like protein SMT3C; SMT3 suppressor of mif two 3 homolog 1; ubiquitin-homology domain protein PIC1
• UniProt Protein Name: Small ubiquitin-related modifier 1
• Protein Family: Small ubiquitin-related modifier
• UniProt Gene Name: SUMO1
• UniProt Synonym Gene Names: SMT3C; SMT3H3; UBL1; SUMO-1; GMP1; Smt3C
• UniProt Entry Name: SUMO1_HUMAN

NCBI Description

This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene. Alternate transcriptional splice variants encoding different isoforms have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

SUMO1: Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. May also regulate a network of genes involved in palate development. Interacts with SAE2, UBE2I, RANBP2, PIAS1 and PIAS2. Interacts with PARK2. Covalently attached to a number of proteins such as IKFZ1, PML, RANGAP1, HIPK2, SP100, p53, p73-alpha, MDM2, JUN, DNMT3B and TDG. Also interacts with HIF1A, HIPK2, HIPK3, CHD3, EXOSC9, RAD51 and RAD52. Interacts with USP25 (via ts SIM domain); the interaction weakly sumoylates USP25. Belongs to the ubiquitin family. SUMO subfamily.

Protein type: Nuclear receptor co-regulator; Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 2q33

Cellular Component: nucleoplasm; PML body; nuclear membrane; cytoplasm; dendrite; fibrillar center; nucleolus; nuclear speck; synapse; nuclear pore; nucleus

Molecular Function: protein binding; ubiquitin protein ligase binding; transcription factor binding; SUMO ligase activity

Biological Process: negative regulation of transcription factor activity; cytokine and chemokine mediated signaling pathway; PML body organization and biogenesis; palate development; DNA repair; post-translational protein modification; negative regulation of DNA binding; positive regulation of protein complex assembly; protein sumoylation; regulation of protein localization; cellular protein metabolic process; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; negative regulation of transcription, DNA-dependent

Disease: Orofacial Cleft 10