<
Western Blot (WB)
(Western Blot detection against Immunogen (47.23kD).)
Mouse anti-Human Stromal Cell Derived Factor 2 Monoclonal Antibody | anti-SDF2 antibody
Stromal Cell Derived Factor 2 (SDF2, Stromal Cell-derived Factor 2, SDF-2) (PE)
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Stromal Cell Derived Factor 2; Monoclonal Antibody; Stromal Cell Derived Factor 2 (SDF2; Stromal Cell-derived Factor 2; SDF-2) (PE); anti-SDF2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G7-1D6
Specificity
Recognizes human SDF2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SDF2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-212 from human SDF2 (AAH00500) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAEL*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (47.23kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (47.23kD).)
Western Blot (WB)
(SDF2 monoclonal antibody, Western Blot analysis of SDF2 expression in WI-38.)
Western Blot (WB)
(SDF2 monoclonal antibody, Western Blot analysis of SDF2 expression in WI-38.)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to SDF2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to SDF2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged SDF2 is 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SDF2 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-SDF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
23,026 Da
NCBI Official Full Name
Homo sapiens stromal cell-derived factor 2, mRNA
NCBI Official Synonym Full Names
stromal cell derived factor 2
NCBI Official Symbol
SDF2
NCBI Protein Information
stromal cell-derived factor 2
Protein Family
NCBI Description
The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. Alternate splicing results in both coding and non-coding variants. A pseudogene of this gene is located on chromosome 15. [provided by RefSeq, Dec 2011]
Research Articles on SDF2
Similar Products
Product Notes
The SDF2 (Catalog #AAA6160561) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Stromal Cell Derived Factor 2 (SDF2, Stromal Cell-derived Factor 2, SDF-2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Stromal Cell Derived Factor 2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SDF2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Stromal Cell Derived Factor 2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
