Mouse anti-Human Stromal Cell Derived Factor 2 Monoclonal Antibody | anti-SDF2 antibody

Stromal Cell Derived Factor 2 (SDF2, Stromal Cell-derived Factor 2, SDF-2) (Biotin)

Cat. Num. AAA6144652

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Stromal Cell Derived Factor 2; Monoclonal Antibody; Stromal Cell Derived Factor 2 (SDF2; Stromal Cell-derived Factor 2; SDF-2) (Biotin); anti-SDF2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3G7-1D6
• Specificity: Recognizes human SDF2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SDF2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-212 from human SDF2 (AAH00500) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAEL*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (47.23kD).)

Western Blot (WB)

(SDF2 monoclonal antibody, Western Blot analysis of SDF2 expression in WI-38.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SDF2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SDF2 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-SDF2 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 38197171
• NCBI GeneID: 6388
• Molecular Weight: 23,026 Da
• NCBI Official Full Name: Homo sapiens stromal cell-derived factor 2, mRNA
• NCBI Official Synonym Full Names: stromal cell derived factor 2
• NCBI Official Symbol: SDF2
• NCBI Protein Information: stromal cell-derived factor 2
• Protein Family: Stromal cell-derived factor

NCBI Description

The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. Alternate splicing results in both coding and non-coding variants. A pseudogene of this gene is located on chromosome 15. [provided by RefSeq, Dec 2011]