Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SRF monoclonal antibody (M03), clone 1E1 Western Blot analysis of SRF expression in Hela S3 NE.)

Mouse SRF Monoclonal Antibody | anti-SRF antibody

SRF (Serum Response Factor (c-fos Serum Response Element-Binding Transcription Factor), MCM1) (AP)

Gene Names
SRF; MCM1
Applications
Western Blot
Purity
Purified
Synonyms
SRF; Monoclonal Antibody; SRF (Serum Response Factor (c-fos Serum Response Element-Binding Transcription Factor); MCM1) (AP); Serum Response Factor (c-fos Serum Response Element-Binding Transcription Factor); MCM1; anti-SRF antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
10
Specificity
Recognizes SRF.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
508
Applicable Applications for anti-SRF antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SRF (AAH48211, 406aa-508aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLDTAHSTKSE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SRF monoclonal antibody (M03), clone 1E1 Western Blot analysis of SRF expression in Hela S3 NE.)

Western Blot (WB) (SRF monoclonal antibody (M03), clone 1E1 Western Blot analysis of SRF expression in Hela S3 NE.)

Western Blot (WB)

(SRF monoclonal antibody (M03), clone 1E1. Western Blot analysis of SRF expression in A-431.)

Western Blot (WB) (SRF monoclonal antibody (M03), clone 1E1. Western Blot analysis of SRF expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged SRF is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SRF is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-SRF antibody
This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs). [provided by RefSeq]
Product Categories/Family for anti-SRF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Serum response factor (c-fos serum response element-binding transcription factor)
NCBI Official Synonym Full Names
serum response factor
NCBI Official Symbol
SRF
NCBI Official Synonym Symbols
MCM1
NCBI Protein Information
serum response factor
Protein Family

NCBI Description

This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2014]

Research Articles on SRF

Similar Products

Product Notes

The SRF (Catalog #AAA6162451) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SRF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SRF for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SRF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.