Mouse SRF Monoclonal Antibody | anti-SRF antibody

SRF (Serum Response Factor (c-fos Serum Response Element-Binding Transcription Factor), MCM1) (PE)

Cat. Num. AAA6185142

• Gene Names: SRF; MCM1
• Applications: Western Blot
• Purity: Purified
• Synonyms: SRF; Monoclonal Antibody; SRF (Serum Response Factor (c-fos Serum Response Element-Binding Transcription Factor); MCM1) (PE); Serum Response Factor (c-fos Serum Response Element-Binding Transcription Factor); MCM1; anti-SRF antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C8
• Specificity: Recognizes SRF.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 508

• Applicable Applications for anti-SRF antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SRF (AAH48211, 406aa-508aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLDTAHSTKSE
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SRF monoclonal antibody (M02), clone 1C8 Western Blot analysis of SRF expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB)

(SRF monoclonal antibody (M02), clone 1C8. Western Blot analysis of SRF expression in HeLa (Cat # L013V1).)

Testing Data

(Detection limit for recombinant GST tagged SRF is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-SRF antibody

This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs). [provided by RefSeq]

Product Categories/Family for anti-SRF antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 29386997
• NCBI GeneID: 6722
• NCBI Official Full Name: Serum response factor (c-fos serum response element-binding transcription factor)
• NCBI Official Synonym Full Names: serum response factor
• NCBI Official Symbol: SRF
• NCBI Official Synonym Symbols: MCM1
• NCBI Protein Information: serum response factor
• Protein Family: Serum response factor

NCBI Description

This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2014]