Rabbit anti-Human CD83 Polyclonal Antibody | anti-CD83 antibody

CD83 (CD83 Antigen, CD83 Molecule, B cell Activation Protein, BL11, Cell Surface Protein HB15, HB15) (HRP)

Cat. Num. AAA6373294

• Gene Names: CD83; BL11; HB15
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD83; Polyclonal Antibody; CD83 (CD83 Antigen; CD83 Molecule; B cell Activation Protein; BL11; Cell Surface Protein HB15; HB15) (HRP); anti-CD83 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CD83.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
• Sequence Length: 205

• Applicable Applications for anti-CD83 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CD83, aa1-205 (AAH30830.1)
• Immunogen Sequence: MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CD83 expression in transfected 293T cell line by CD83 polyclonal antibody. Lane 1: CD83 transfected lysate (23kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CD83 antibody

CD83 is a 45kD type I transmembrane protein. It belongs to immunoglobulin superfamily and is expressed on mature dendritic cells and activated lymphocytes. CD83 is involved in the regulation of T cell development and immune response. Soluble form CD83 has been reported to inhibit dendritic cell maturation and dendritic cell-mediated T cell proliferation. Murine CD83 ligand has been found on B cells.

Product Categories/Family for anti-CD83 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 21410827
• NCBI GeneID: 9308
• NCBI Accession #: AAH30830.1
• NCBI GenBank Nucleotide #: NM_004233.3
• NCBI Official Full Name: CD83 molecule
• NCBI Official Synonym Full Names: CD83 molecule
• NCBI Official Symbol: CD83
• NCBI Official Synonym Symbols: BL11; HB15
• NCBI Protein Information: CD83 antigen
• Protein Family: CD83 antigen

NCBI Description

The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]