Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.69kD).)

Mouse anti-Human SLURP1 Monoclonal Antibody | anti-SLURP1 antibody

SLURP1 (Secreted Ly-6/uPAR-related Protein 1, SLURP-1, Anti-neoplastic Urinary Protein, ANUP, ARS Component B, ArsB, ARS(component B)-81/S, ARS, LY6LS, MDM) (FITC)

Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLURP1; Monoclonal Antibody; SLURP1 (Secreted Ly-6/uPAR-related Protein 1; SLURP-1; Anti-neoplastic Urinary Protein; ANUP; ARS Component B; ArsB; ARS(component B)-81/S; ARS; LY6LS; MDM) (FITC); anti-SLURP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D1
Specificity
Recognizes human SLURP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
103
Applicable Applications for anti-SLURP1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa25-103 from human SLURP1 (NP_065160) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.69kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.69kD).)

Western Blot (WB)

(Western Blot analysis of SLURP1 expression in transfected 293T cell line by SLURP1 monoclonal antibody. Lane 1: SLURP1 transfected lysate (11.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SLURP1 expression in transfected 293T cell line by SLURP1 monoclonal antibody. Lane 1: SLURP1 transfected lysate (11.2kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of SLURP1 transfected lysate using SLURP1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SLURP1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of SLURP1 transfected lysate using SLURP1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SLURP1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged SLURP1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLURP1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-SLURP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
secreted Ly-6/uPAR-related protein 1
UniProt Protein Name
Secreted Ly-6/uPAR-related protein 1
UniProt Gene Name
SLURP1
UniProt Synonym Gene Names
ARS; SLURP-1; ANUP
UniProt Entry Name
SLUR1_HUMAN

Uniprot Description

SLURP1: Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin. Defects in SLURP1 are a cause of Mal de Meleda (MDM); also known as keratosis palmoplantaris transgradiens of Siemens. MDM is a rare autosomal recessive skin disorder, characterized by diffuse transgressive palmoplantar keratoderma with keratotic lesions extending onto the dorsa of the hands and the feet (transgrediens). Patients may have hyperhidrosis. Other features include perioral erythema, lichenoid plaques on the knees and the elbows, and nail abnormalities.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: extracellular space; extracellular region

Molecular Function: cytokine activity

Biological Process: neuromuscular process controlling posture; cell activation; locomotory behavior; cell adhesion

Disease: Mal De Meleda

Similar Products

Product Notes

The SLURP1 slurp1 (Catalog #AAA6149763) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLURP1 (Secreted Ly-6/uPAR-related Protein 1, SLURP-1, Anti-neoplastic Urinary Protein, ANUP, ARS Component B, ArsB, ARS(component B)-81/S, ARS, LY6LS, MDM) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLURP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLURP1 slurp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLURP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.