Mouse anti-Human SLURP1 Monoclonal Antibody | anti-SLURP1 antibody

SLURP1 (Secreted Ly-6/uPAR-related Protein 1, SLURP-1, Anti-neoplastic Urinary Protein, ANUP, ARS Component B, ArsB, ARS(component B)-81/S, ARS, LY6LS, MDM) (HRP)

Cat. Num. AAA6155066

• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SLURP1; Monoclonal Antibody; SLURP1 (Secreted Ly-6/uPAR-related Protein 1; SLURP-1; Anti-neoplastic Urinary Protein; ANUP; ARS Component B; ArsB; ARS(component B)-81/S; ARS; LY6LS; MDM) (HRP); anti-SLURP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4D1
• Specificity: Recognizes human SLURP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 103

• Applicable Applications for anti-SLURP1 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa25-103 from human SLURP1 (NP_065160) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.69kD).)

Western Blot (WB)

(Western Blot analysis of SLURP1 expression in transfected 293T cell line by SLURP1 monoclonal antibody. Lane 1: SLURP1 transfected lysate (11.2kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of SLURP1 transfected lysate using SLURP1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SLURP1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged SLURP1 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-SLURP1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 9966907
• NCBI Accession #: NP_065160
• NCBI GenBank Nucleotide #: NM_020427
• UniProt Accession #: P55000
• NCBI Official Full Name: secreted Ly-6/uPAR-related protein 1
• UniProt Protein Name: Secreted Ly-6/uPAR-related protein 1
• Protein Family: Secreted Ly-6/uPAR-related protein
• UniProt Gene Name: SLURP1
• UniProt Synonym Gene Names: ARS; SLURP-1; ANUP
• UniProt Entry Name: SLUR1_HUMAN

Uniprot Description

SLURP1: Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin. Defects in SLURP1 are a cause of Mal de Meleda (MDM); also known as keratosis palmoplantaris transgradiens of Siemens. MDM is a rare autosomal recessive skin disorder, characterized by diffuse transgressive palmoplantar keratoderma with keratotic lesions extending onto the dorsa of the hands and the feet (transgrediens). Patients may have hyperhidrosis. Other features include perioral erythema, lichenoid plaques on the knees and the elbows, and nail abnormalities.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: extracellular space; extracellular region

Molecular Function: cytokine activity

Biological Process: neuromuscular process controlling posture; cell activation; locomotory behavior; cell adhesion

Disease: Mal De Meleda