Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SLURP1 expression in transfected 293T cell line by SLURP1 polyclonal antibody. Lane 1: SLURP1 transfected lysate (11.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SLURP1 Polyclonal Antibody | anti-SLURP1 antibody

SLURP1 (Secreted Ly-6/uPAR-related Protein 1, SLURP-1, Anti-neoplastic Urinary Protein, ANUP, ARS Component B, ArsB, ARS(component B)-81/S, ARS, LY6LS, MDM)

Gene Names
SLURP1; ARS; MDM; ANUP; ArsB; LY6LS
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLURP1; Polyclonal Antibody; SLURP1 (Secreted Ly-6/uPAR-related Protein 1; SLURP-1; Anti-neoplastic Urinary Protein; ANUP; ARS Component B; ArsB; ARS(component B)-81/S; ARS; LY6LS; MDM); Anti -SLURP1 (Secreted Ly-6/uPAR-related Protein 1; anti-SLURP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SLURP1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Applicable Applications for anti-SLURP1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SLURP1, aa1-103 (NP_065160.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SLURP1 expression in transfected 293T cell line by SLURP1 polyclonal antibody. Lane 1: SLURP1 transfected lysate (11.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SLURP1 expression in transfected 293T cell line by SLURP1 polyclonal antibody. Lane 1: SLURP1 transfected lysate (11.2kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SLURP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,186 Da
NCBI Official Full Name
secreted Ly-6/uPAR-related protein 1
NCBI Official Synonym Full Names
secreted LY6/PLAUR domain containing 1
NCBI Official Symbol
SLURP1
NCBI Official Synonym Symbols
ARS; MDM; ANUP; ArsB; LY6LS
NCBI Protein Information
secreted Ly-6/uPAR-related protein 1; SLURP-1; ARS(component B)-81/S; anti-neoplastic urinary protein; lymphocyte antigen 6-like secreted; secreted Ly6/uPAR related protein 1
UniProt Protein Name
Secreted Ly-6/uPAR-related protein 1
UniProt Gene Name
SLURP1
UniProt Synonym Gene Names
ARS; SLURP-1; ANUP
UniProt Entry Name
SLUR1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. [provided by RefSeq, Jul 2008]

Uniprot Description

SLURP1: Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin. Defects in SLURP1 are a cause of Mal de Meleda (MDM); also known as keratosis palmoplantaris transgradiens of Siemens. MDM is a rare autosomal recessive skin disorder, characterized by diffuse transgressive palmoplantar keratoderma with keratotic lesions extending onto the dorsa of the hands and the feet (transgrediens). Patients may have hyperhidrosis. Other features include perioral erythema, lichenoid plaques on the knees and the elbows, and nail abnormalities.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: extracellular space; extracellular region

Molecular Function: cytokine activity

Biological Process: cell activation; neuromuscular process controlling posture; locomotory behavior; cell adhesion

Disease: Mal De Meleda

Research Articles on SLURP1

Similar Products

Product Notes

The SLURP1 slurp1 (Catalog #AAA6009389) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLURP1 (Secreted Ly-6/uPAR-related Protein 1, SLURP-1, Anti-neoplastic Urinary Protein, ANUP, ARS Component B, ArsB, ARS(component B)-81/S, ARS, LY6LS, MDM) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLURP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SLURP1 slurp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASRWAVQLL LVAAWSMGCG EALKCYTCKE PMTSASCRTI TRCKPEDTAC MTTLVTVEAE YPFNQSPVVT RSCSSSCVAT DPDSIGAAHL IFCCFRDLCN SEL. It is sometimes possible for the material contained within the vial of "SLURP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.