Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human RNF14 Monoclonal Antibody | anti-RNF14 antibody

RNF14 (ARA54, E3 Ubiquitin-protein Ligase RNF14, Androgen Receptor-associated Protein 54, HFB30, RING Finger Protein 14, Triad2 Protein) (Biotin)

Gene Names
RNF14; ARA54; HFB30; TRIAD2; HRIHFB2038
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RNF14; Monoclonal Antibody; RNF14 (ARA54; E3 Ubiquitin-protein Ligase RNF14; Androgen Receptor-associated Protein 54; HFB30; RING Finger Protein 14; Triad2 Protein) (Biotin); anti-RNF14 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G9
Specificity
Recognizes human RNF14.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
4170
Applicable Applications for anti-RNF14 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa217-316 from RNF14 (NP_004281) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of RNF14 expression in transfected 293T cell line by RNF14 monoclonal antibody. Lane 1: RNF14 transfected lysate (39.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RNF14 expression in transfected 293T cell line by RNF14 monoclonal antibody. Lane 1: RNF14 transfected lysate (39.6kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RNF14 on HeLa cell. [antibody concentration 10ug/ml)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RNF14 on HeLa cell. [antibody concentration 10ug/ml)

Testing Data

(Detection limit for recombinant GST tagged RNF14 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RNF14 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of RNF14 over-expressed 293 cell line, cotransfected with RNF14 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF14 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of RNF14 over-expressed 293 cell line, cotransfected with RNF14 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF14 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-RNF14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ring finger protein 14 (RNF14), transcript variant 1, mRNA
NCBI Official Synonym Full Names
ring finger protein 14
NCBI Official Symbol
RNF14
NCBI Official Synonym Symbols
ARA54; HFB30; TRIAD2; HRIHFB2038
NCBI Protein Information
E3 ubiquitin-protein ligase RNF14
UniProt Protein Name
E3 ubiquitin-protein ligase RNF14
UniProt Gene Name
RNF14
UniProt Synonym Gene Names
ARA54
UniProt Entry Name
RNF14_HUMAN

NCBI Description

The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq, Jan 2011]

Uniprot Description

RNF14: Might act as an E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates, which could be nuclear proteins. Could play a role as a coactivator for androgen- and, to a lesser extent, progesterone-dependent transcription. Belongs to the RBR family. RNF14 subfamily.

Protein type: Ubiquitin conjugating system; Nuclear receptor co-regulator; Ubiquitin ligase; EC 6.3.2.-; EC 6.3.2.19; Transcription, coactivator/corepressor; Ligase

Chromosomal Location of Human Ortholog: 5q23.3-q31.1

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; androgen receptor binding; small conjugating protein ligase activity; zinc ion binding; transcription coactivator activity; ligase activity

Biological Process: regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; androgen receptor signaling pathway; protein ubiquitination; signal transduction; response to estradiol stimulus

Research Articles on RNF14

Similar Products

Product Notes

The RNF14 rnf14 (Catalog #AAA6144068) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RNF14 (ARA54, E3 Ubiquitin-protein Ligase RNF14, Androgen Receptor-associated Protein 54, HFB30, RING Finger Protein 14, Triad2 Protein) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RNF14 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNF14 rnf14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RNF14, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.