Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RNF14 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: COLO205 cell lysateRNF14 is supported by BioGPS gene expression data to be expressed in COLO205)

Rabbit RNF14 Polyclonal Antibody | anti-RNF14 antibody

RNF14 antibody - N-terminal region

Gene Names
RNF14; ARA54; HFB30; TRIAD2; HRIHFB2038
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RNF14; Polyclonal Antibody; RNF14 antibody - N-terminal region; anti-RNF14 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFV
Sequence Length
474
Applicable Applications for anti-RNF14 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RNF14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RNF14 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: COLO205 cell lysateRNF14 is supported by BioGPS gene expression data to be expressed in COLO205)

Western Blot (WB) (WB Suggested Anti-RNF14 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: COLO205 cell lysateRNF14 is supported by BioGPS gene expression data to be expressed in COLO205)
Related Product Information for anti-RNF14 antibody
This is a rabbit polyclonal antibody against RNF14. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RNF14 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative m

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF14 isoform 1
NCBI Official Synonym Full Names
ring finger protein 14
NCBI Official Symbol
RNF14
NCBI Official Synonym Symbols
ARA54; HFB30; TRIAD2; HRIHFB2038
NCBI Protein Information
E3 ubiquitin-protein ligase RNF14
UniProt Protein Name
E3 ubiquitin-protein ligase RNF14
UniProt Gene Name
RNF14
UniProt Synonym Gene Names
ARA54
UniProt Entry Name
RNF14_HUMAN

NCBI Description

The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq, Jan 2011]

Uniprot Description

RNF14: Might act as an E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates, which could be nuclear proteins. Could play a role as a coactivator for androgen- and, to a lesser extent, progesterone-dependent transcription. Belongs to the RBR family. RNF14 subfamily.

Protein type: Ubiquitin conjugating system; Nuclear receptor co-regulator; Ubiquitin ligase; EC 6.3.2.-; EC 6.3.2.19; Transcription, coactivator/corepressor; Ligase

Chromosomal Location of Human Ortholog: 5q23.3-q31.1

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; androgen receptor binding; small conjugating protein ligase activity; zinc ion binding; transcription coactivator activity; ligase activity

Biological Process: regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; androgen receptor signaling pathway; protein ubiquitination; signal transduction; response to estradiol stimulus

Research Articles on RNF14

Similar Products

Product Notes

The RNF14 rnf14 (Catalog #AAA3204087) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF14 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RNF14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNF14 rnf14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSSEDREAQE DELLALASIY DGDEFRKAES VQGGETRIYL DLPQNFKIFV. It is sometimes possible for the material contained within the vial of "RNF14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.