Mouse anti-Human RNF14 Monoclonal Antibody | anti-RNF14 antibody

RNF14 (ARA54, E3 Ubiquitin-protein Ligase RNF14, Androgen Receptor-associated Protein 54, HFB30, RING Finger Protein 14, Triad2 Protein) APC

Cat. Num. AAA6138765

• Gene Names: RNF14; ARA54; HFB30; TRIAD2; HRIHFB2038
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RNF14; Monoclonal Antibody; RNF14 (ARA54; E3 Ubiquitin-protein Ligase RNF14; Androgen Receptor-associated Protein 54; HFB30; RING Finger Protein 14; Triad2 Protein) APC; anti-RNF14 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G9
• Specificity: Recognizes human RNF14.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 4170

• Applicable Applications for anti-RNF14 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa217-316 from RNF14 (NP_004281) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQL
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of RNF14 expression in transfected 293T cell line by RNF14 monoclonal antibody. Lane 1: RNF14 transfected lysate (39.6kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RNF14 on HeLa cell. [antibody concentration 10ug/ml)

Testing Data

(Detection limit for recombinant GST tagged RNF14 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of RNF14 over-expressed 293 cell line, cotransfected with RNF14 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF14 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-RNF14 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 1519246170
• NCBI GeneID: 9604
• NCBI Accession #: NM_004290.5
• NCBI GenBank Nucleotide #: NM_004290
• UniProt Accession #: Q9UBS8
• NCBI Official Full Name: Homo sapiens ring finger protein 14 (RNF14), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: ring finger protein 14
• NCBI Official Symbol: RNF14
• NCBI Official Synonym Symbols: ARA54; HFB30; TRIAD2; HRIHFB2038
• NCBI Protein Information: E3 ubiquitin-protein ligase RNF14
• UniProt Protein Name: E3 ubiquitin-protein ligase RNF14
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: RNF14
• UniProt Synonym Gene Names: ARA54
• UniProt Entry Name: RNF14_HUMAN

NCBI Description

The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq, Jan 2011]

Uniprot Description

RNF14: Might act as an E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates, which could be nuclear proteins. Could play a role as a coactivator for androgen- and, to a lesser extent, progesterone-dependent transcription. Belongs to the RBR family. RNF14 subfamily.

Protein type: Ubiquitin conjugating system; Nuclear receptor co-regulator; Ubiquitin ligase; EC 6.3.2.-; EC 6.3.2.19; Transcription, coactivator/corepressor; Ligase

Chromosomal Location of Human Ortholog: 5q23.3-q31.1

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; androgen receptor binding; small conjugating protein ligase activity; zinc ion binding; transcription coactivator activity; ligase activity

Biological Process: regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; androgen receptor signaling pathway; protein ubiquitination; signal transduction; response to estradiol stimulus