Rabbit anti-Human RNF14 Polyclonal Antibody | anti-RNF14 antibody

RNF14 (ARA54, E3 Ubiquitin-protein Ligase RNF14, Androgen Receptor-associated Protein 54, HFB30, RING Finger Protein 14, Triad2 Protein) (AP)

Cat. Num. AAA6392705

• Gene Names: RNF14; ARA54; HFB30; TRIAD2; HRIHFB2038
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RNF14; Polyclonal Antibody; RNF14 (ARA54; E3 Ubiquitin-protein Ligase RNF14; Androgen Receptor-associated Protein 54; HFB30; RING Finger Protein 14; Triad2 Protein) (AP); anti-RNF14 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RNF14.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 2992

• Applicable Applications for anti-RNF14 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human RNF14, aa1-348 (NP_899645.1).
• Immunogen Sequence: MQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RNF14 expression in transfected 293T cell line by RNF14 polyclonal antibody. Lane 1: RNF14 transfected lysate (39.6kD). Lane 2: Non-transfected lysate. )

Related Product Information for anti-RNF14 antibody

The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Five alternatively spliced transcript variants encoding two distinct isoforms have been reported.

Product Categories/Family for anti-RNF14 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 34577095
• NCBI GeneID: 9604
• NCBI Accession #: NM_183398.1
• NCBI GenBank Nucleotide #: NM_183398.1
• NCBI Official Full Name: Homo sapiens ring finger protein 14 (RNF14), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: ring finger protein 14
• NCBI Official Symbol: RNF14
• NCBI Official Synonym Symbols: ARA54; HFB30; TRIAD2; HRIHFB2038
• NCBI Protein Information: E3 ubiquitin-protein ligase RNF14
• Protein Family: E3 ubiquitin-protein ligase

NCBI Description

The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq, Jan 2011]