Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RBP2 expression in transfected 293T cell line by RBP2 monoclonal antibody. Lane 1: RBP2 transfected lysate (15.7kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human RBP2 Monoclonal Antibody | anti-RBP2 antibody

RBP2 (Retinol-binding Protein 2, Cellular Retinol-binding Protein II, CRBP-II, CRBP2) (Biotin)

Gene Names
RBP2; CRBP2; RBPC2; CRBPII; CRABP-II
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RBP2; Monoclonal Antibody; RBP2 (Retinol-binding Protein 2; Cellular Retinol-binding Protein II; CRBP-II; CRBP2) (Biotin); anti-RBP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G12
Specificity
Recognizes human RBP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RBP2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa45-135, from human RBP2 (NP_004155) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RBP2 expression in transfected 293T cell line by RBP2 monoclonal antibody. Lane 1: RBP2 transfected lysate (15.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RBP2 expression in transfected 293T cell line by RBP2 monoclonal antibody. Lane 1: RBP2 transfected lysate (15.7kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-RBP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18 kDa (158aa) confirmed by MALDI-TOF
NCBI Official Full Name
retinol-binding protein 2
NCBI Official Synonym Full Names
retinol binding protein 2
NCBI Official Symbol
RBP2
NCBI Official Synonym Symbols
CRBP2; RBPC2; CRBPII; CRABP-II
NCBI Protein Information
retinol-binding protein 2
UniProt Protein Name
Retinol-binding protein 2
Protein Family
UniProt Gene Name
RBP2
UniProt Synonym Gene Names
CRBP2; CRBP-II
UniProt Entry Name
RET2_HUMAN

NCBI Description

This gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. This protein may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle. [provided by RefSeq, Aug 2015]

Uniprot Description

RBP2: Intracellular transport of retinol. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Chromosomal Location of Human Ortholog: 3q23

Cellular Component: cytosol

Molecular Function: retinoid binding; transporter activity; retinol binding; retinal binding

Biological Process: phototransduction, visible light; epidermis development; transport; retinoid metabolic process; vitamin A metabolic process

Research Articles on RBP2

Similar Products

Product Notes

The RBP2 rbp2 (Catalog #AAA6143968) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RBP2 (Retinol-binding Protein 2, Cellular Retinol-binding Protein II, CRBP-II, CRBP2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBP2 rbp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.