Mouse anti-Human RBP2 Monoclonal Antibody | anti-RBP2 antibody

RBP2 (Retinol-binding Protein 2, Cellular Retinol-binding Protein II, CRBP-II, CRBP2) (PE)

Cat. Num. AAA6159877

• Gene Names: RBP2; CRBP2; RBPC2; CRBPII; CRABP-II
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RBP2; Monoclonal Antibody; RBP2 (Retinol-binding Protein 2; Cellular Retinol-binding Protein II; CRBP-II; CRBP2) (PE); anti-RBP2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G12
• Specificity: Recognizes human RBP2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-RBP2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa45-135, from human RBP2 (NP_004155) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RBP2 expression in transfected 293T cell line by RBP2 monoclonal antibody. Lane 1: RBP2 transfected lysate (15.7kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-RBP2 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 40354214
• NCBI GeneID: 5948
• NCBI Accession #: NP_004155
• NCBI GenBank Nucleotide #: NM_004164
• UniProt Accession #: P50120; Q6ISQ9; Q6ISS7; A8K7G3
• Molecular Weight: 18 kDa (158aa) confirmed by MALDI-TOF
• NCBI Official Full Name: retinol-binding protein 2
• NCBI Official Synonym Full Names: retinol binding protein 2
• NCBI Official Symbol: RBP2
• NCBI Official Synonym Symbols: CRBP2; RBPC2; CRBPII; CRABP-II
• NCBI Protein Information: retinol-binding protein 2
• UniProt Protein Name: Retinol-binding protein 2
• Protein Family: RNA-binding protein
• UniProt Gene Name: RBP2
• UniProt Synonym Gene Names: CRBP2; CRBP-II
• UniProt Entry Name: RET2_HUMAN

NCBI Description

This gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. This protein may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle. [provided by RefSeq, Aug 2015]

Uniprot Description

RBP2: Intracellular transport of retinol. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Chromosomal Location of Human Ortholog: 3q23

Cellular Component: cytosol

Molecular Function: retinoid binding; transporter activity; retinol binding; retinal binding

Biological Process: phototransduction, visible light; epidermis development; transport; retinoid metabolic process; vitamin A metabolic process