Mouse anti-Human ZNF138 Monoclonal Antibody | anti-ZNF138 antibody
ZNF138 (Zinc Finger Protein 138, PHZ-32)
Gene Names
ZNF138; pHZ-32
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ZNF138; Monoclonal Antibody; ZNF138 (Zinc Finger Protein 138; PHZ-32); Anti -ZNF138 (Zinc Finger Protein 138; anti-ZNF138 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D11
Specificity
Recognizes human ZNF138.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
TNLSKPKKIHTGEKPYKCEVCGKAFHQSSILTKHKIIRTGEKPYKCAHCGKAFKQSSHLTRHKIIHTEEKPYKCEQCGKVFKQSPTLTKHQIIYTGEEPYK*
Applicable Applications for anti-ZNF138 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa151-251 from human ZNF138 (NP_006515) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Product Categories/Family for anti-ZNF138 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,592 Da
NCBI Official Full Name
zinc finger protein 138 isoform 4
NCBI Official Synonym Full Names
zinc finger protein 138
NCBI Official Symbol
ZNF138
NCBI Official Synonym Symbols
pHZ-32
NCBI Protein Information
zinc finger protein 138; zinc finger protein 138 (clone pHZ-32)
UniProt Protein Name
Zinc finger protein 138
Protein Family
UniProt Gene Name
ZNF138
UniProt Entry Name
ZN138_HUMAN
Uniprot Description
Function: May be involved in transcriptional regulation as a repressor.
Subcellular location: Nucleus
Potential.
Sequence similarities: Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 6 C2H2-type zinc fingers.
Research Articles on ZNF138
Similar Products
Product Notes
The ZNF138 znf138 (Catalog #AAA648448) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF138 (Zinc Finger Protein 138, PHZ-32) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF138 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the ZNF138 znf138 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TNLSKPKKIH TGEKPYKCEV CGKAFHQSSI LTKHKIIRTG EKPYKCAHCG KAFKQSSHLT RHKIIHTEEK PYKCEQCGKV FKQSPTLTKH QIIYTGEEPY K*. It is sometimes possible for the material contained within the vial of "ZNF138, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
