Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to RALGPS2 on HeLa cell. [antibody concentration 10 ug/ml])
Mouse RALGPS2 Monoclonal Antibody | anti-RALGPS2 antibody
RALGPS2 (Ral GEF with PH Domain and SH3 Binding Motif 2, FLJ10244, FLJ25604, KIAA0351, dJ595C2.1) (Biotin)
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
RALGPS2; Monoclonal Antibody; RALGPS2 (Ral GEF with PH Domain and SH3 Binding Motif 2; FLJ10244; FLJ25604; KIAA0351; dJ595C2.1) (Biotin); Ral GEF with PH Domain and SH3 Binding Motif 2; dJ595C2.1; anti-RALGPS2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A5
Specificity
Recognizes RALGPS2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
583
Applicable Applications for anti-RALGPS2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RALGPS2 (NP_689876, 282aa-386aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LKIEPGTSTPRSAASREDLVGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to RALGPS2 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to RALGPS2 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to RALGPS2 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to RALGPS2 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-RALGPS2 antibody
Mouse monoclonal antibody raised against a partial recombinant RALGPS2.
Product Categories/Family for anti-RALGPS2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ras-specific guanine nucleotide-releasing factor RalGPS2 isoform 1
UniProt Protein Name
Ras-specific guanine nucleotide-releasing factor RalGPS2
Protein Family
UniProt Gene Name
RALGPS2
UniProt Entry Name
RGPS2_HUMAN
Similar Products
Product Notes
The RALGPS2 ralgps2 (Catalog #AAA6172746) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RALGPS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RALGPS2 ralgps2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RALGPS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
