Rabbit anti-Human RALGPS2 Polyclonal Antibody | anti-RALGPS2 antibody

RALGPS2 (Ras-specific Guanine Nucleotide-releasing Factor RalGPS2, RalA Exchange Factor RalGPS2, Ral GEF with PH Domain and SH3-binding Motif 2, FLJ10244, FLJ25604)

Cat. Num. AAA6003879

• Gene Names: RALGPS2; dJ595C2.1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: RALGPS2; Polyclonal Antibody; RALGPS2 (Ras-specific Guanine Nucleotide-releasing Factor RalGPS2; RalA Exchange Factor RalGPS2; Ral GEF with PH Domain and SH3-binding Motif 2; FLJ10244; FLJ25604); Anti -RALGPS2 (Ras-specific Guanine Nucleotide-releasing Factor RalGPS2; anti-RALGPS2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RALGPS2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTPEEYAGQITLMDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEVLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKEDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDIPMLPHVQKYLNSVQYIEELQKFVEDDNYK

• Applicable Applications for anti-RALGPS2 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human RALGPS2, aa1-279 (NP_060507.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RALGPS2 expression in transfected 293T cell line by RALGPS2 polyclonal antibody. Lane 1: RALGPS2 transfected lysate (31.9kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RALGPS2 antibody

Guanine nucleotide exchange factor for the small GTPase RALA. May be involved in cytoskeletal organization. May also be involved in the stimulation of transcription in a Ras-independent fashion.

Product Categories/Family for anti-RALGPS2 antibody

Antibodies; Abs to GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 32441283
• NCBI GeneID: 55103
• NCBI Accession #: NP_689876.2
• NCBI GenBank Nucleotide #: NM_152663.3
• UniProt Accession #: Q86X27; Q5T5Z1; Q5VZ67; Q9NW78
• Molecular Weight: 65,167 Da
• NCBI Official Full Name: ras-specific guanine nucleotide-releasing factor RalGPS2
• NCBI Official Synonym Full Names: Ral GEF with PH domain and SH3 binding motif 2
• NCBI Official Symbol: RALGPS2
• NCBI Official Synonym Symbols: dJ595C2.1
• NCBI Protein Information: ras-specific guanine nucleotide-releasing factor RalGPS2; ralA exchange factor RalGPS2; Ral-A exchange factor RalGPS2; ral GEF with PH domain and SH3-binding motif 2
• UniProt Protein Name: Ras-specific guanine nucleotide-releasing factor RalGPS2
• Protein Family: Ras-specific guanine nucleotide-releasing factor
• UniProt Gene Name: RALGPS2
• UniProt Entry Name: RGPS2_HUMAN

Uniprot Description

RALGPS2: Guanine nucleotide exchange factor for the small GTPase RALA. May be involved in cytoskeletal organization. May also be involved in the stimulation of transcription in a Ras-independent fashion. RALGPS2 is a potential candidate gene for susceptibility to Alzheimer disease linked to 1q24. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs; GEFs, Ras

Chromosomal Location of Human Ortholog: 1q25.2

Cellular Component: cytoplasm; plasma membrane

Molecular Function: guanyl-nucleotide exchange factor activity

Biological Process: small GTPase mediated signal transduction; positive regulation of GTPase activity