Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RAC2 expression in transfected 293T cell line by RAC2 monoclonal antibody. Lane 1: RAC2 transfected lysate (21.4kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human RAC2 Monoclonal Antibody | anti-RAC2 antibody

RAC2 (Ras-Related C3 Botulinum Toxin Substrate, 2GX, Small G-Protein, p21-Rac2) (FITC)

Gene Names
RAC2; Gx; EN-7; HSPC022; p21-Rac2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAC2; Monoclonal Antibody; RAC2 (Ras-Related C3 Botulinum Toxin Substrate; 2GX; Small G-Protein; p21-Rac2) (FITC); anti-RAC2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B8
Specificity
Recognizes human RAC2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-RAC2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-193 from human RAC2 (AAH01485) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RAC2 expression in transfected 293T cell line by RAC2 monoclonal antibody. Lane 1: RAC2 transfected lysate (21.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RAC2 expression in transfected 293T cell line by RAC2 monoclonal antibody. Lane 1: RAC2 transfected lysate (21.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RAC2 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RAC2 is 1ng/ml as a capture antibody.)
Related Product Information for anti-RAC2 antibody
RAC2 is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases.
Product Categories/Family for anti-RAC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
21,429 Da
NCBI Official Full Name
Homo sapiens ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2), mRNA
NCBI Official Synonym Full Names
ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
NCBI Official Symbol
RAC2
NCBI Official Synonym Symbols
Gx; EN-7; HSPC022; p21-Rac2
NCBI Protein Information
ras-related C3 botulinum toxin substrate 2
Protein Family

NCBI Description

This gene encodes a member of the Ras superfamily of small guanosine triphosphate (GTP)-metabolizing proteins. The encoded protein localizes to the plasma membrane, where it regulates diverse processes, such as secretion, phagocytosis, and cell polarization. Activity of this protein is also involved in the generation of reactive oxygen species. Mutations in this gene are associated with neutrophil immunodeficiency syndrome. There is a pseudogene for this gene on chromosome 6. [provided by RefSeq, Jul 2013]

Research Articles on RAC2

Similar Products

Product Notes

The RAC2 (Catalog #AAA6149197) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAC2 (Ras-Related C3 Botulinum Toxin Substrate, 2GX, Small G-Protein, p21-Rac2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAC2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAC2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAC2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.