Rabbit anti-Human RAC3 Polyclonal Antibody | anti-RAC3 antibody

RAC3 (Ras-Related C3 Botulinum Toxin Substrate 3, p21-Rac3) (PE)

Cat. Num. AAA6391813

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RAC3; Polyclonal Antibody; RAC3 (Ras-Related C3 Botulinum Toxin Substrate 3; p21-Rac3) (PE); anti-RAC3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RAC3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-RAC3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human RAC3, aa1-192 (NP_005043.1).
• Immunogen Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RAC3 expression in transfected 293T cell line by RAC3 polyclonal antibody. Lane 1: RAC3 transfected lysate (21.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RAC3 antibody

The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. [provided by RefSeq].

Product Categories/Family for anti-RAC3 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4826962
• NCBI GeneID: 5881
• NCBI Accession #: NP_005043.1
• NCBI GenBank Nucleotide #: NM_005052
• UniProt Accession #: P60763; O14658; Q5U0M8
• Molecular Weight: 21,379 Da
• NCBI Official Full Name: ras-related C3 botulinum toxin substrate 3
• NCBI Official Synonym Full Names: ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
• NCBI Official Symbol: RAC3
• NCBI Protein Information: ras-related C3 botulinum toxin substrate 3; p21-Rac3; rho family, small GTP binding protein Rac3
• UniProt Protein Name: Ras-related C3 botulinum toxin substrate 3
• Protein Family: Rac-like GTP-binding protein
• UniProt Gene Name: RAC3
• UniProt Entry Name: RAC3_HUMAN

NCBI Description

The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. [provided by RefSeq, Jul 2008]

Uniprot Description

RAC3: Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Interacts with the GEF protein DOCK7, which promotes the exchange between GDP and GTP, and therefore activates it. Interacts with C1D. Expression down-regulated in quiescent fibroblasts and clearly induced by serum stimulation. Highest levels in brain, also detected in heart, placenta and pancreas. Belongs to the small GTPase superfamily. Rho family.

Protein type: Motility/polarity/chemotaxis; G protein; G protein, monomeric; G protein, monomeric, Rho

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: filamentous actin; neuron projection; growth cone; cell soma; perinuclear region of cytoplasm; lamellipodium; plasma membrane; endomembrane system; cytosol

Molecular Function: GTPase activity; protein binding; GTP binding; calcium-dependent protein binding

Biological Process: regulation of small GTPase mediated signal transduction; metabolic process; small GTPase mediated signal transduction; positive regulation of cell adhesion mediated by integrin; cell projection biogenesis; actin cytoskeleton organization and biogenesis; neuromuscular process controlling balance; neurite development