Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti-CYP27B1 Picoband antibody, MBS177955, Western blottingAll lanes: Anti CYP27B1 (MBS177955) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Mouse Kidney Tissue Lysate at 50ugLane 3: 293T Whole Cell Lysate at 40ugPredicted bind size: 57KDObserved bind size: 57KD)

CYP27B1 Polyclonal Antibody | anti-CYP27B1 antibody

Anti-CYP27B1 Antibody

Gene Names
CYP27B1; VDR; CP2B; CYP1; PDDR; VDD1; VDDR; VDDRI; CYP27B; P450c1; CYP1alpha
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
CYP27B1; Polyclonal Antibody; Anti-CYP27B1 Antibody; 25-hydroxyvitamin D-1 alpha hydroxylase; 1alpha(OH)ase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; 25-OHD-1 alpha-hydroxylase; Calcidiol 1-monooxygenase; CP27B_HUMAN; CP2B; CYP1; CYP1ALPHA; CYP27B; Cyp27b1; Cytochrome p450 27B1; Cytochrome p450 27B13; Cytochrome P450 family 27 subfamily B polypeptide 1; Cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1; Cytochrome P450 subfamily XXVIIB polypeptide 1; Cytochrome P450C1 alpha; Cytochrome P450VD1-alpha; mitochondrial; P450C1 alpha; P450c1; P450C1-alpha; P450VD1-alpha; PDDR; VD3 1A hydroxylase; VDD1; VDDR; VDDR I; VDDRI; VDR; cytochrome P450; family 27; subfamily B; polypeptide 1; anti-CYP27B1 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
508
Applicable Applications for anti-CYP27B1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CYP27B1 (475-508aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR), different from the related mouse and rat sequences by six amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti-CYP27B1 Picoband antibody, MBS177955, Western blottingAll lanes: Anti CYP27B1 (MBS177955) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Mouse Kidney Tissue Lysate at 50ugLane 3: 293T Whole Cell Lysate at 40ugPredicted bind size: 57KDObserved bind size: 57KD)

Western Blot (WB) (Anti-CYP27B1 Picoband antibody, MBS177955, Western blottingAll lanes: Anti CYP27B1 (MBS177955) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Mouse Kidney Tissue Lysate at 50ugLane 3: 293T Whole Cell Lysate at 40ugPredicted bind size: 57KDObserved bind size: 57KD)

Immunohistochemistry (IHC)

(Anti-CYP27B1 Picoband antibody, MBS177955, IHC(P)IHC(P): Rat Kidney Tissue )

Immunohistochemistry (IHC) (Anti-CYP27B1 Picoband antibody, MBS177955, IHC(P)IHC(P): Rat Kidney Tissue )

Immunohistochemistry (IHC)

(Anti-CYP27B1 Picoband antibody, MBS177955, IHC(P)IHC(P): Human Kidney Cancer Tissue )

Immunohistochemistry (IHC) (Anti-CYP27B1 Picoband antibody, MBS177955, IHC(P)IHC(P): Human Kidney Cancer Tissue )
Related Product Information for anti-CYP27B1 antibody
Description: Rabbit IgG polyclonal antibody for 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial (CYP27B1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: CYP27B1 belongs to the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I.
References
1. "Entrez Gene: cytochrome P450". 2. Monkawa T, Yoshida T, Wakino S, Shinki T, Anazawa H, Deluca HF et al. (Oct 1997). "Molecular cloning of cDNA and genomic DNA for human 25-hydroxyvitamin D3 1 alpha-hydroxylase". Biochemical and Biophysical Research Communications 239 (2): 527-33. 3. Takeyama K, Kitanaka S, Sato T, Kobori M, Yanagisawa J, Kato S (Sep 1997). "25-Hydroxyvitamin D3 1alpha-hydroxylase and vitamin D synthesis". Science (New York, N.Y.) 277 (5333): 1827-30.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,504 Da
NCBI Official Full Name
25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
NCBI Official Synonym Full Names
cytochrome P450 family 27 subfamily B member 1
NCBI Official Symbol
CYP27B1
NCBI Official Synonym Symbols
VDR; CP2B; CYP1; PDDR; VDD1; VDDR; VDDRI; CYP27B; P450c1; CYP1alpha
NCBI Protein Information
25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
UniProt Protein Name
25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
UniProt Gene Name
CYP27B1
UniProt Synonym Gene Names
CYP1ALPHA; CYP27B; VD3 1A hydroxylase
UniProt Entry Name
CP27B_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP27B1: Catalyzes the conversion of 25-hydroxyvitamin D3 (25(OH)D) to 1-alpha,25-dihydroxyvitamin D3 (1,25(OH)2D) plays an important role in normal bone growth, calcium metabolism, and tissue differentiation. Defects in CYP27B1 are the cause of rickets vitamin D- dependent type 1A (VDDR1A); also known as pseudovitamin D deficiency rickets (PDDR). A disorder caused by a selective deficiency of the active form of vitamin D (1,25- dihydroxyvitamin D3) and resulting in defective bone mineralization and clinical features of rickets. Belongs to the cytochrome P450 family.

Protein type: Oxidoreductase; Lipid Metabolism - steroid biosynthesis; Mitochondrial; EC 1.14.13.13; Cell cycle regulation

Chromosomal Location of Human Ortholog: 12q14.1

Cellular Component: cytoplasm; mitochondrial outer membrane; mitochondrion

Molecular Function: calcidiol 1-monooxygenase activity; heme binding; iron ion binding

Biological Process: bone mineralization; calcium ion homeostasis; calcium ion transport; decidualization; negative regulation of cell growth; negative regulation of cell proliferation; positive regulation of keratinocyte differentiation; regulation of bone mineralization; response to estrogen stimulus; response to lipopolysaccharide; response to vitamin D; vitamin D catabolic process; vitamin D metabolic process; vitamin metabolic process

Disease: Vitamin D Hydroxylation-deficient Rickets, Type 1a

Research Articles on CYP27B1

Similar Products

Product Notes

The CYP27B1 cyp27b1 (Catalog #AAA177955) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-CYP27B1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CYP27B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml. Researchers should empirically determine the suitability of the CYP27B1 cyp27b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CYP27B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.