Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.19kD).)

Mouse anti-Human PRF1 Monoclonal Antibody | anti-PRF1 antibody

PRF1 (Perforin-1, Perforin 1, MGC65093, P1, Cytolysin, Lymphocyte Pore-forming Protein, PFN1, PFP) (AP)

Gene Names
PRF1; P1; PFP; HPLH2
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRF1; Monoclonal Antibody; PRF1 (Perforin-1; Perforin 1; MGC65093; P1; Cytolysin; Lymphocyte Pore-forming Protein; PFN1; PFP) (AP); anti-PRF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B4
Specificity
Recognizes human PRF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PRF1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa461-555 from human PRF1 (NP_005032) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.19kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.19kD).)

Western Blot (WB)

(Western Blot analysis of PRF1 expression in transfected 293T cell line by PRF1 monoclonal antibody Lane 1: PRF1 transfected lysate (61.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PRF1 expression in transfected 293T cell line by PRF1 monoclonal antibody Lane 1: PRF1 transfected lysate (61.4kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of PRF1 transfected lysate using PRF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PRF1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of PRF1 transfected lysate using PRF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PRF1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged PRF1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PRF1 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-PRF1 antibody
Perforin is a 70kD cytolytic protein that is expressed in the cytoplasmic granules of cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells. Perforin is one of the major effector molecules used by cytotoxic T cells and NK cells to mediate targeted cell lysis.
Product Categories/Family for anti-PRF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
perforin-1
NCBI Official Synonym Full Names
perforin 1
NCBI Official Symbol
PRF1
NCBI Official Synonym Symbols
P1; PFP; HPLH2
NCBI Protein Information
perforin-1
UniProt Protein Name
Perforin-1
Protein Family
UniProt Gene Name
PRF1
UniProt Synonym Gene Names
PFP; P1; PFP
UniProt Entry Name
PERF_HUMAN

NCBI Description

This gene encodes a protein with structural similarities to complement component C9 that is important in immunity. This protein forms membrane pores that allow the release of granzymes and subsequent cytolysis of target cells. Whether pore formation occurs in the plasma membrane of target cells or in an endosomal membrane inside target cells is subject to debate. Mutations in this gene are associated with a variety of human disease including diabetes, multiple sclerosis, lymphomas, autoimmune lymphoproliferative syndrome (ALPS), aplastic anemia, and familial hemophagocytic lymphohistiocytosis type 2 (FHL2), a rare and lethal autosomal recessive disorder of early childhood. [provided by RefSeq, Aug 2017]

Uniprot Description

PRF1: Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Plays an important role in killing other cells that are recognized as non-self by the immune system, e.g. in transplant rejection or some forms of autoimmune disease. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes. Monomer, as sobluble protein. Homooligomer. Oligomerization is required for pore formation. Repressed by contact with target cells. Belongs to the complement C6/C7/C8/C9 family.

Protein type: Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 10q22

Cellular Component: membrane; cytoplasmic membrane-bound vesicle; integral to membrane; extracellular region; plasma membrane

Molecular Function: protein binding; calcium ion binding; wide pore channel activity

Biological Process: formation of immunological synapse; apoptosis; cytolysis; defense response to tumor cell; cellular defense response; immune response to tumor cell; defense response to virus; transmembrane transport; protein homooligomerization

Disease: Lymphoma, Non-hodgkin, Familial; Aplastic Anemia; Hemophagocytic Lymphohistiocytosis, Familial, 2

Research Articles on PRF1

Similar Products

Product Notes

The PRF1 prf1 (Catalog #AAA6133120) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRF1 (Perforin-1, Perforin 1, MGC65093, P1, Cytolysin, Lymphocyte Pore-forming Protein, PFN1, PFP) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRF1 prf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.