Mouse anti-Human PRF1 Monoclonal Antibody | anti-PRF1 antibody

PRF1 (Perforin-1, Perforin 1, MGC65093, P1, Cytolysin, Lymphocyte Pore-forming Protein, PFN1, PFP) (Biotin)

Cat. Num. AAA6143726

• Gene Names: PRF1; P1; PFP; HPLH2
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PRF1; Monoclonal Antibody; PRF1 (Perforin-1; Perforin 1; MGC65093; P1; Cytolysin; Lymphocyte Pore-forming Protein; PFN1; PFP) (Biotin); anti-PRF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B4
• Specificity: Recognizes human PRF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PRF1 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa461-555 from human PRF1 (NP_005032) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: WSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.19kD).)

Western Blot (WB)

(Western Blot analysis of PRF1 expression in transfected 293T cell line by PRF1 monoclonal antibody Lane 1: PRF1 transfected lysate (61.4kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of PRF1 transfected lysate using PRF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PRF1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged PRF1 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-PRF1 antibody

Perforin is a 70kD cytolytic protein that is expressed in the cytoplasmic granules of cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells. Perforin is one of the major effector molecules used by cytotoxic T cells and NK cells to mediate targeted cell lysis.

Product Categories/Family for anti-PRF1 antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 40254808
• NCBI GeneID: 5551
• NCBI Accession #: NP_005032
• NCBI GenBank Nucleotide #: NM_005041
• UniProt Accession #: P14222
• Molecular Weight: 59kDa
• NCBI Official Full Name: perforin-1
• NCBI Official Synonym Full Names: perforin 1
• NCBI Official Symbol: PRF1
• NCBI Official Synonym Symbols: P1; PFP; HPLH2
• NCBI Protein Information: perforin-1
• UniProt Protein Name: Perforin-1
• Protein Family: Perforin
• UniProt Gene Name: PRF1
• UniProt Synonym Gene Names: PFP; P1; PFP
• UniProt Entry Name: PERF_HUMAN

NCBI Description

This gene encodes a protein with structural similarities to complement component C9 that is important in immunity. This protein forms membrane pores that allow the release of granzymes and subsequent cytolysis of target cells. Whether pore formation occurs in the plasma membrane of target cells or in an endosomal membrane inside target cells is subject to debate. Mutations in this gene are associated with a variety of human disease including diabetes, multiple sclerosis, lymphomas, autoimmune lymphoproliferative syndrome (ALPS), aplastic anemia, and familial hemophagocytic lymphohistiocytosis type 2 (FHL2), a rare and lethal autosomal recessive disorder of early childhood. [provided by RefSeq, Aug 2017]

Uniprot Description

PRF1: Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Plays an important role in killing other cells that are recognized as non-self by the immune system, e.g. in transplant rejection or some forms of autoimmune disease. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes. Monomer, as sobluble protein. Homooligomer. Oligomerization is required for pore formation. Repressed by contact with target cells. Belongs to the complement C6/C7/C8/C9 family.

Protein type: Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 10q22

Cellular Component: membrane; cytoplasmic membrane-bound vesicle; integral to membrane; extracellular region; plasma membrane

Molecular Function: protein binding; calcium ion binding; wide pore channel activity

Biological Process: formation of immunological synapse; apoptosis; cytolysis; defense response to tumor cell; cellular defense response; immune response to tumor cell; defense response to virus; transmembrane transport; protein homooligomerization

Disease: Lymphoma, Non-hodgkin, Familial; Aplastic Anemia; Hemophagocytic Lymphohistiocytosis, Familial, 2