Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse POLR2F Monoclonal Antibody | anti-POLR2F antibody

POLR2F (Polymerase (RNA) II (DNA Directed) Polypeptide F, HRBP14.4, POLRF, RPABC2, RPB14.4, RPB6) (MaxLight 750)

Gene Names
POLR2F; RPB6; POLRF; RPC15; RPABC2; RPB14.4; HRBP14.4; RPABC14.4
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
POLR2F; Monoclonal Antibody; POLR2F (Polymerase (RNA) II (DNA Directed) Polypeptide F; HRBP14.4; POLRF; RPABC2; RPB14.4; RPB6) (MaxLight 750); Polymerase (RNA) II (DNA Directed) Polypeptide F; RPB6; anti-POLR2F antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G2
Specificity
Recognizes POLR2F.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-POLR2F antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
POLR2F (NP_068809.1, 1aa-127aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-POLR2F antibody
This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes, that is also shared by the other two DNA-directed RNA polymerases. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilizes the transcribing polymerase on the DNA template. [provided by RefSeq]
Product Categories/Family for anti-POLR2F antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14,478 Da
NCBI Official Full Name
Homo sapiens polymerase (RNA) II (DNA directed) polypeptide F (POLR2F), transcript variant 1, mRNA
NCBI Official Synonym Full Names
polymerase (RNA) II (DNA directed) polypeptide F
NCBI Official Symbol
POLR2F
NCBI Official Synonym Symbols
RPB6; POLRF; RPC15; RPABC2; RPB14.4; HRBP14.4; RPABC14.4
NCBI Protein Information
DNA-directed RNA polymerases I, II, and III subunit RPABC2; DNA-directed RNA polymerase II subunit F; DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide; RNA Polymerase II subunit 14.4 kD; RNA polymerases I, II, and III subunit ABC2

NCBI Description

This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilizes the transcribing polymerase on the DNA template. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Research Articles on POLR2F

Similar Products

Product Notes

The POLR2F (Catalog #AAA6240012) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's POLR2F can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POLR2F for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POLR2F, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.