Mouse anti-Human PGAP1 Monoclonal Antibody | anti-PGAP1 antibody

PGAP1 (GPI Inositol-deacylase, Post-GPI Attachment to Proteins Factor 1, hPGAP1, UNQ3024/PRO9822) (HRP)

Cat. Num. AAA6154107

• Gene Names: PGAP1; Bst1; MRT42; SPG67; ISPD3024
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PGAP1; Monoclonal Antibody; PGAP1 (GPI Inositol-deacylase; Post-GPI Attachment to Proteins Factor 1; hPGAP1; UNQ3024/PRO9822) (HRP); anti-PGAP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5G6
• Specificity: Recognizes human PGAP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 922

• Applicable Applications for anti-PGAP1 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa168-267 from human PGAP1 (NP_079265) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSAL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PGAP1 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-PGAP1 antibody

Involved in inositol deacylation of GPI-anchored proteins. GPI inositol deacylation may important for efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi.

Product Categories/Family for anti-PGAP1 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 46240862
• NCBI GeneID: 80055
• NCBI Accession #: NP_079265
• NCBI GenBank Nucleotide #: NM_024989
• UniProt Accession #: Q75T13
• NCBI Official Full Name: GPI inositol-deacylase isoform 1
• NCBI Official Synonym Full Names: post-GPI attachment to proteins inositol deacylase 1
• NCBI Official Symbol: PGAP1
• NCBI Official Synonym Symbols: Bst1; MRT42; SPG67; ISPD3024
• NCBI Protein Information: GPI inositol-deacylase
• UniProt Protein Name: GPI inositol-deacylase
• UniProt Gene Name: PGAP1
• UniProt Synonym Gene Names: hPGAP1

NCBI Description

The protein encoded by this gene functions early in the glycosylphosphatidylinositol (GPI) biosynthetic pathway, catalyzing the inositol deacylation of GPI. The encoded protein is required for the production of GPI that can attach to proteins, and this may be an important factor in the transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi. Defects in this gene are a cause an autosomal recessive form of cognitive impairment. [provided by RefSeq, Jul 2017]

Uniprot Description

PGAP1: Involved in inositol deacylation of GPI-anchored proteins. GPI inositol deacylation may important for efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi. Belongs to the GPI inositol-deacylase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.-.-; Glycan Metabolism - glycosylphosphatidylinositol (GPI)-anchor biosynthesis; Hydrolase; Lipase; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 2q33.1

Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; integral component of membrane

Molecular Function: hydrolase activity, acting on ester bonds; nuclease activity; phosphoric ester hydrolase activity

Biological Process: anterior/posterior axis specification; attachment of GPI anchor to protein; embryonic pattern specification; forebrain regionalization; myo-inositol transport; protein transport; sensory perception of sound

Disease: Mental Retardation, Autosomal Recessive 42