Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse anti-Human PGAP1 Monoclonal Antibody | anti-PGAP1 antibody

PGAP1 (GPI Inositol-deacylase, Post-GPI Attachment to Proteins Factor 1, hPGAP1, UNQ3024/PRO9822) (Biotin)

Gene Names
PGAP1; Bst1; MRT42; SPG67; ISPD3024
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PGAP1; Monoclonal Antibody; PGAP1 (GPI Inositol-deacylase; Post-GPI Attachment to Proteins Factor 1; hPGAP1; UNQ3024/PRO9822) (Biotin); anti-PGAP1 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5G6
Specificity
Recognizes human PGAP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
922
Applicable Applications for anti-PGAP1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa168-267 from human PGAP1 (NP_079265) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSAL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PGAP1 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-PGAP1 antibody
Involved in inositol deacylation of GPI-anchored proteins. GPI inositol deacylation may important for efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi.
Product Categories/Family for anti-PGAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
GPI inositol-deacylase isoform 1
NCBI Official Synonym Full Names
post-GPI attachment to proteins inositol deacylase 1
NCBI Official Symbol
PGAP1
NCBI Official Synonym Symbols
Bst1; MRT42; SPG67; ISPD3024
NCBI Protein Information
GPI inositol-deacylase
UniProt Protein Name
GPI inositol-deacylase
UniProt Gene Name
PGAP1
UniProt Synonym Gene Names
hPGAP1

NCBI Description

The protein encoded by this gene functions early in the glycosylphosphatidylinositol (GPI) biosynthetic pathway, catalyzing the inositol deacylation of GPI. The encoded protein is required for the production of GPI that can attach to proteins, and this may be an important factor in the transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi. Defects in this gene are a cause an autosomal recessive form of cognitive impairment. [provided by RefSeq, Jul 2017]

Uniprot Description

PGAP1: Involved in inositol deacylation of GPI-anchored proteins. GPI inositol deacylation may important for efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi. Belongs to the GPI inositol-deacylase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.-.-; Glycan Metabolism - glycosylphosphatidylinositol (GPI)-anchor biosynthesis; Hydrolase; Lipase; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 2q33.1

Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; integral component of membrane

Molecular Function: hydrolase activity, acting on ester bonds; nuclease activity; phosphoric ester hydrolase activity

Biological Process: anterior/posterior axis specification; attachment of GPI anchor to protein; embryonic pattern specification; forebrain regionalization; myo-inositol transport; protein transport; sensory perception of sound

Disease: Mental Retardation, Autosomal Recessive 42

Research Articles on PGAP1

Similar Products

Product Notes

The PGAP1 pgap1 (Catalog #AAA6143501) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PGAP1 (GPI Inositol-deacylase, Post-GPI Attachment to Proteins Factor 1, hPGAP1, UNQ3024/PRO9822) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PGAP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PGAP1 pgap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PGAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual