Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PSCD2 monoclonal antibody Western Blot analysis of PSCD2 expression in PC-12.)

Mouse anti-Human, Rat PSCD2 Monoclonal Antibody | anti-PSCD2 antibody

PSCD2 (CYTH2, ARNO, PSCD2L, Cytohesin-2, ARF Exchange Factor, ARF Nucleotide-binding Site Opener, PH, SEC7 and Coiled-coil Domain-containing Protein 2, Protein ARNO) (Biotin)

Gene Names
CYTH2; ARNO; CTS18; PSCD2; SEC7L; PSCD2L; CTS18.1; Sec7p-L; Sec7p-like; cytohesin-2
Reactivity
Human, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PSCD2; Monoclonal Antibody; PSCD2 (CYTH2; ARNO; PSCD2L; Cytohesin-2; ARF Exchange Factor; ARF Nucleotide-binding Site Opener; PH; SEC7 and Coiled-coil Domain-containing Protein 2; Protein ARNO) (Biotin); anti-PSCD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6H5
Specificity
Recognizes human PSCD2. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PSCD2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa314-398 from PSCD2 (NP_059431) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PSCD2 monoclonal antibody Western Blot analysis of PSCD2 expression in PC-12.)

Western Blot (WB) (PSCD2 monoclonal antibody Western Blot analysis of PSCD2 expression in PC-12.)

Western Blot (WB)

(Western Blot analysis of CYTH2 expression in transfected 293T cell line by PSCD2 monoclonal antibody. Lane 1: CYTH2 transfected lysate (46.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CYTH2 expression in transfected 293T cell line by PSCD2 monoclonal antibody. Lane 1: CYTH2 transfected lysate (46.5kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PSCD2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PSCD2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PSCD2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PSCD2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PSCD2 is ~0.03ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged PSCD2 is ~0.03ng/ml as a capture antibody)
Product Categories/Family for anti-PSCD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
cytohesin-2 isoform 1
NCBI Official Synonym Full Names
cytohesin 2
NCBI Official Symbol
CYTH2
NCBI Official Synonym Symbols
ARNO; CTS18; PSCD2; SEC7L; PSCD2L; CTS18.1; Sec7p-L; Sec7p-like; cytohesin-2
NCBI Protein Information
cytohesin-2
UniProt Protein Name
Cytohesin-2
UniProt Gene Name
CYTH2
UniProt Synonym Gene Names
ARNO; PSCD2; PSCD2L; Protein ARNO
UniProt Entry Name
CYH2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with ARF1, ARF3, and ARF6 and is 83% homologous to CYTH1. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

Uniprot Description

cytohesin 2: Acts as a guanine-nucleotide exchange factor (GEF). Promotes guanine-nucleotide exchange on ARF1, ARF3 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. The cell membrane form, in association with ARL4 proteins, recruits ARF6 to the plasma membrane. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs; GEFs, ARF

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: membrane; cytoplasm; plasma membrane; trans-Golgi network

Molecular Function: protein binding; lipid binding; ARF guanyl-nucleotide exchange factor activity

Biological Process: regulation of cell adhesion; vesicle-mediated transport; endocytosis; regulation of ARF protein signal transduction; actin cytoskeleton organization and biogenesis; positive regulation of GTPase activity

Research Articles on PSCD2

Similar Products

Product Notes

The PSCD2 cyth2 (Catalog #AAA6143782) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PSCD2 (CYTH2, ARNO, PSCD2L, Cytohesin-2, ARF Exchange Factor, ARF Nucleotide-binding Site Opener, PH, SEC7 and Coiled-coil Domain-containing Protein 2, Protein ARNO) (Biotin) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PSCD2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PSCD2 cyth2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PSCD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.