Testing Data
(Detection limit for recombinant GST tagged ANKS1 is ~3ng/ml as a capture antibody.)
Mouse anti-Human ANKS1A Monoclonal Antibody | anti-ANKS1A antibody
ANKS1A (Ankyrin Repeat and SAM Domain-containing Protein 1A, Odin, ANKS1, KIAA0229, ODIN) (HRP)
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ANKS1A; Monoclonal Antibody; ANKS1A (Ankyrin Repeat and SAM Domain-containing Protein 1A; Odin; ANKS1; KIAA0229; ODIN) (HRP); anti-ANKS1A antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6B11
Specificity
Recognizes human ANKS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1134
Applicable Applications for anti-ANKS1A antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1037-1133 from ANKS1 (NP_056060) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQKSRATGASAAEMIETKSSKPVPKPRVGVRKSALEPPDMDQDAQSHASVSWVVDPKPDSKRSLS*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged ANKS1 is ~3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ANKS1 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-ANKS1A antibody
Regulator of different signaling pathways. Regulates EPHA8 receptor tyrosine kinase signaling to control cell migration and neurite retraction.
Product Categories/Family for anti-ANKS1A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ankyrin repeat and SAM domain-containing protein 1A
UniProt Protein Name
Ankyrin repeat and SAM domain-containing protein 1A
Protein Family
UniProt Gene Name
ANKS1A
UniProt Synonym Gene Names
ANKS1; KIAA0229; ODIN
UniProt Entry Name
ANS1A_HUMAN
Uniprot Description
ANKS1A: protein of unknown function. Contains seven ankyrin repeats and two sterile alpha motif domain.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 6p21.31
Cellular Component: nucleoplasm; neuron projection; cytoplasm
Molecular Function: protein binding
Biological Process: substrate-bound cell migration; ephrin receptor signaling pathway; neuron remodeling
Similar Products
Product Notes
The ANKS1A anks1a (Catalog #AAA6151212) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ANKS1A (Ankyrin Repeat and SAM Domain-containing Protein 1A, Odin, ANKS1, KIAA0229, ODIN) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANKS1A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ANKS1A anks1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANKS1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
