Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.75kD).)

Mouse anti-Human PDE2A Monoclonal Antibody | anti-PDE2A antibody

PDE2A (cGMP-dependent 3',5'-cyclic Phosphodiesterase, Cyclic GMP-stimulated Phosphodiesterase, CGS-PDE, cGSPDE) (PE)

Gene Names
PDE2A; PDE2A1; PED2A4; cGSPDE; CGS-PDE
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PDE2A; Monoclonal Antibody; PDE2A (cGMP-dependent 3'; 5'-cyclic Phosphodiesterase; Cyclic GMP-stimulated Phosphodiesterase; CGS-PDE; cGSPDE) (PE); anti-PDE2A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F4
Specificity
Recognizes human PDE2A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PDE2A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa850-940 from human PDE2A (NP_002590) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.75kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.75kD).)

Western Blot (WB)

(PDE2A monoclonal antibody. Western Blot analysis of PDE2A expression in IMR-32.)

Western Blot (WB) (PDE2A monoclonal antibody. Western Blot analysis of PDE2A expression in IMR-32.)

Testing Data

(Detection limit for recombinant GST tagged PDE2A is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PDE2A is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-PDE2A antibody
Phosphodiesterase 2A is a cGMP stimulated, cAMP/cGMP dual-specific phosphodiesterase whose hydrolytic activity is stimulated by the presence of cGMP binding to the GAF domain. PDE2A has been implicated in penile erectile dysfunction and in the regulation of fluid and inflammatory cell transit across the endothelial cell barrier (i.e., venous and capillary). PDE2A activity is inhibited by erythro-9-(2-hydroxyl-3-nonyl)adenine (EHNA). At least three isoforms have been reported (PDE2A1, PDE2A2, and PDE2A3).
Product Categories/Family for anti-PDE2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87,235 Da
NCBI Official Full Name
cGMP-dependent 3',5'-cyclic phosphodiesterase isoform PDE2A3
NCBI Official Synonym Full Names
phosphodiesterase 2A, cGMP-stimulated
NCBI Official Symbol
PDE2A
NCBI Official Synonym Symbols
PDE2A1; PED2A4; cGSPDE; CGS-PDE
NCBI Protein Information
cGMP-dependent 3',5'-cyclic phosphodiesterase
UniProt Protein Name
cGMP-dependent 3',5'-cyclic phosphodiesterase
UniProt Gene Name
PDE2A
UniProt Synonym Gene Names
CGS-PDE; cGSPDE
UniProt Entry Name
PDE2A_HUMAN

Uniprot Description

PDE2A: Cyclic nucleotide phosphodiesterase with a dual- specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Belongs to the cyclic nucleotide phosphodiesterase family. PDE2 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Phosphodiesterase; EC 3.1.4.17; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 11q13.4

Cellular Component: presynaptic membrane; Golgi apparatus; mitochondrial matrix; axon; endoplasmic reticulum; perinuclear region of cytoplasm; dendrite; cytoplasm; plasma membrane; nucleus; cytosol

Molecular Function: protein binding; protein homodimerization activity; TPR domain binding; calcium channel activity; metal ion binding; cGMP-stimulated cyclic-nucleotide phosphodiesterase activity; cGMP binding; cyclic-nucleotide phosphodiesterase activity; drug binding; cAMP binding

Biological Process: monocyte differentiation; metabolic process; cGMP-mediated signaling; cAMP catabolic process; negative regulation of transcription from RNA polymerase II promoter; positive regulation of vascular permeability; cAMP-mediated signaling; negative regulation of cAMP biosynthetic process; negative regulation of protein import into nucleus, translocation; negative regulation of vascular permeability; regulation of cGMP metabolic process; cGMP catabolic process; blood coagulation; protein targeting to mitochondrion; positive regulation of inflammatory response

Research Articles on PDE2A

Similar Products

Product Notes

The PDE2A pde2a (Catalog #AAA6159362) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDE2A (cGMP-dependent 3',5'-cyclic Phosphodiesterase, Cyclic GMP-stimulated Phosphodiesterase, CGS-PDE, cGSPDE) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDE2A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDE2A pde2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDE2A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.