Mouse anti-Human PDE2A Monoclonal Antibody | anti-PDE2A antibody

PDE2A (cGMP-dependent 3',5'-cyclic Phosphodiesterase, Cyclic GMP-stimulated Phosphodiesterase, CGS-PDE, cGSPDE) (HRP)

Cat. Num. AAA6154059

• Gene Names: PDE2A; PDE2A1; PED2A4; cGSPDE; CGS-PDE
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PDE2A; Monoclonal Antibody; PDE2A (cGMP-dependent 3'; 5'-cyclic Phosphodiesterase; Cyclic GMP-stimulated Phosphodiesterase; CGS-PDE; cGSPDE) (HRP); anti-PDE2A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4F4
• Specificity: Recognizes human PDE2A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PDE2A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa850-940 from human PDE2A (NP_002590) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.75kD).)

Western Blot (WB)

(PDE2A monoclonal antibody. Western Blot analysis of PDE2A expression in IMR-32.)

Testing Data

(Detection limit for recombinant GST tagged PDE2A is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-PDE2A antibody

Phosphodiesterase 2A is a cGMP stimulated, cAMP/cGMP dual-specific phosphodiesterase whose hydrolytic activity is stimulated by the presence of cGMP binding to the GAF domain. PDE2A has been implicated in penile erectile dysfunction and in the regulation of fluid and inflammatory cell transit across the endothelial cell barrier (i.e., venous and capillary). PDE2A activity is inhibited by erythro-9-(2-hydroxyl-3-nonyl)adenine (EHNA). At least three isoforms have been reported (PDE2A1, PDE2A2, and PDE2A3).

Product Categories/Family for anti-PDE2A antibody

Antibodies; Enzymes; Phosphodiesterase

NCBI and Uniprot Product Information

• NCBI GI #: 4505657
• NCBI GeneID: 5138
• NCBI Accession #: NP_002590
• NCBI GenBank Nucleotide #: NM_002599
• UniProt Accession #: O00408; Q5J791; Q5J792; Q5J793; Q6ZMR1; B2R646; B3KRV5; E9PGI1; F6W5Z0
• Molecular Weight: 87,235 Da
• NCBI Official Full Name: cGMP-dependent 3',5'-cyclic phosphodiesterase isoform PDE2A3
• NCBI Official Synonym Full Names: phosphodiesterase 2A, cGMP-stimulated
• NCBI Official Symbol: PDE2A
• NCBI Official Synonym Symbols: PDE2A1; PED2A4; cGSPDE; CGS-PDE
• NCBI Protein Information: cGMP-dependent 3',5'-cyclic phosphodiesterase
• UniProt Protein Name: cGMP-dependent 3',5'-cyclic phosphodiesterase
• Protein Family: cGMP-dependent 3',5'-cyclic phosphodiesterase
• UniProt Gene Name: PDE2A
• UniProt Synonym Gene Names: CGS-PDE; cGSPDE
• UniProt Entry Name: PDE2A_HUMAN

Uniprot Description

PDE2A: Cyclic nucleotide phosphodiesterase with a dual- specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Belongs to the cyclic nucleotide phosphodiesterase family. PDE2 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Phosphodiesterase; EC 3.1.4.17; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 11q13.4

Cellular Component: presynaptic membrane; Golgi apparatus; mitochondrial matrix; axon; endoplasmic reticulum; perinuclear region of cytoplasm; dendrite; cytoplasm; plasma membrane; nucleus; cytosol

Molecular Function: protein binding; protein homodimerization activity; TPR domain binding; calcium channel activity; metal ion binding; cGMP-stimulated cyclic-nucleotide phosphodiesterase activity; cGMP binding; cyclic-nucleotide phosphodiesterase activity; drug binding; cAMP binding

Biological Process: monocyte differentiation; metabolic process; cGMP-mediated signaling; cAMP catabolic process; negative regulation of transcription from RNA polymerase II promoter; positive regulation of vascular permeability; cAMP-mediated signaling; negative regulation of cAMP biosynthetic process; negative regulation of protein import into nucleus, translocation; negative regulation of vascular permeability; regulation of cGMP metabolic process; cGMP catabolic process; blood coagulation; protein targeting to mitochondrion; positive regulation of inflammatory response